UniProt UniProt http://www.uniprot.org Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. J. Immunol. (0022-1767) 2009 imex curation Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions human-mel_juso Homo sapiens mel_juso anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl Accepted 2014-APR-17 by MGT J. Immunol. (0022-1767) 2009 Only protein-protein interactions imex curation Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. J. Immunol. (0022-1767) 2009 imex curation Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions human-akbm Homo sapiens EBV positive Burkitt's lymphoma B cell line akbm EBV positive Burkitt's lymphoma B cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins Incubated with anti-IgG to induce productive EBV infection. M.E.Ressing@lumc.nl Accepted 2014-APR-17 by MGT J. Immunol. (0022-1767) 2009 Only protein-protein interactions imex curation Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. J. Immunol. (0022-1767) 2009 imex curation Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions human-mel_juso Homo sapiens mel_juso fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl Accepted 2014-APR-17 by MGT J. Immunol. (0022-1767) 2009 Only protein-protein interactions imex curation Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. J. Immunol. (0022-1767) 2009 imex curation Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions human-lcl_modo Homo sapiens LCL lymphoblastoid cell line donor MoDo, in vitro transformed EBV-positive lcl_modo LCL lymphoblastoid cell line donor MoDo, in vitro transformed EBV-positive anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl Accepted 2014-APR-17 by MGT J. Immunol. (0022-1767) 2009 Only protein-protein interactions imex curation Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. J. Immunol. (0022-1767) 2009 imex curation Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions human-t2 Homo sapiens T cell leukemia/B cell line hybridoma HLA-A2-positive, TAP negative t2 T cell leukemia/B cell line hybridoma HLA-A2-positive, TAP negative ATCC CRL-1992 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl Accepted 2014-APR-17 by MGT J. Immunol. (0022-1767) 2009 Only protein-protein interactions imex curation Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. J. Immunol. (0022-1767) 2009 imex curation Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions human-akbm Homo sapiens EBV positive Burkitt's lymphoma B cell line akbm EBV positive Burkitt's lymphoma B cell line confocal microscopy confocal microscopy immunostaining immunostaining Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl Accepted 2014-APR-17 by MGT J. Immunol. (0022-1767) 2009 Only protein-protein interactions imex curation Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. J. Immunol. (0022-1767) 2009 imex curation Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions human-mel_juso Homo sapiens mel_juso anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins CoIPs depicted fig 3B not included as the anti-bait antibodies used are not specific. M.E.Ressing@lumc.nl Accepted 2014-APR-17 by MGT J. Immunol. (0022-1767) 2009 Only protein-protein interactions imex curation Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. J. Immunol. (0022-1767) 2009 imex curation Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions human-220 Homo sapiens 220 220 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl Accepted 2014-APR-17 by MGT J. Immunol. (0022-1767) 2009 Only protein-protein interactions imex curation calx_human Calnexin CANX Major histocompatibility complex class I antigen-binding protein p88 p90 IP90 protein protein human Homo sapiens Human MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE DIP protein P27824 original sequence version: 177 EDE094D9B82261EE tap2_human Antigen peptide transporter 2 ATP-binding cassette sub-family B member 3 Peptide transporter TAP2 Peptide supply factor 2 Peptide transporter PSF2 Peptide transporter involved in antigen processing 2 TAP2 ABCB3 PSF2 RING11 Y1 Really interesting new gene 11 protein protein protein human Homo sapiens Human MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLGFVGTLLLPLCLATPLTVSLRALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLSPPGAQEKEQDQVNNKVLMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDILGGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINLRIREQLFSSLLRQDLGFFQETKTGELNSRLSSDTTLMSNWLPLNANVLLRSLVKVVGLYGFMLSISPRLTLLSLLHMPFTIAAEKVYNTRHQEVLREIQDAVARAGQVVREAVGGLQTVRSFGAEEHEVCRYKEALEQCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQDGELTQGSLLSFMIYQESVGSYVQTLVYIYGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL DIP protein Q03519 original sequence version: 123 DIP protein Q03519 original sequence version: 176 E7E4A7F6A2A3B48B tpsn_human Tapasin TAP-binding protein TAP-associated protein NGS-17 TAPBP NGS17 TAPA protein protein human Homo sapiens Human MKSLSLLLAVALGLATAVSAGPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALDGAWLMVSISSPVLSLSSLLRPQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDLSFAYMPPTSEAASSLAPGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEPWGPWTGNGTFWLPRVQPFQEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPATLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSVSLSGHLQPPPVTTEQHGARYACRIHHPSLPASGRSAEVTLEVAGLSGPSLEDSVGLFLSAFLLLGLFKALGWAAVYLSTCKDSKKKAE 7340549519B288AD bnl2a_ebvb9 Protein BNLF2a BNLF2a protein protein ebvb9 Epstein-Barr virus (strain B95-8) (HHV-4) Human herpesvirus 4 HHV-4 MVHVLERALLEQQSSACGLPGSSTETRPSHPCPEDPDVSRLRLLLVVLCVLFGLLCLLLI 19EAE809410982EA tap1_human Antigen peptide transporter 1 ABCB2 PSF1 RING4 Y3 TAP1 Peptide transporter TAP1 ATP-binding cassette sub-family B member 2 Peptide supply factor 1 Peptide transporter PSF1 Peptide transporter involved in antigen processing 1 Really interesting new gene 4 protein protein protein human Homo sapiens Human MAELLASAGSACSWDFPRAPPSFPPPAASRGGLGGTRSFRPHRGAESPRPGRDRDGVRVPMASSRCPAPRGCRCLPGASLAWLGTVLLLLADWVLLRTALPRIFSLLVPTALPLLRVWAVGLSRWAVLWLGACGVLRATVGSKSENAGAQGWLAALKPLAAALGLALPGLALFRELISWGAPGSADSTRLLHWGSHPTAFVVSYAAALPAAALWHKLGSLWVPGGQGGSGNPVRRLLGCLGSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTEDTSTLSDSLSENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTLITLPLLFLLPKKVGKWYQLLEVQVRESLAKSSQVAIEALSAMPTVRSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVNSWTTSISGMLLKVGILYIGGQLVTSGAVSSGNLVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE DIP protein Q03518 original sequence version: 123 DIP protein Q03518 original sequence version: 173 9CA5FF96FADD6A1B bnl2a-tap1 3 12 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 13 unspecified role unspecified role neutral component neutral component c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 1B tap1-bnl2a-1 7 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association 3A tap2-bnl2a 7 10 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association 3A tapbp-tap1 7 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association 3A tap2-bnl2a-1 1 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Replacement of the 4 cysteine residues by alanine did not change the interaction physical association physical association 4B tapbp-bnl2a-1 1 11 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Replacement of the 4 cysteine residues by alanine did not change the interaction physical association physical association 4B tap1-bnl2a-2 1 13 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Replacement of the 4 cysteine residues by alanine did not change the interaction physical association physical association 4B tap2-bnl2a-2 4 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Replacement of the 4 cysteine residues by alanine did not change the interaction 10 unspecified role unspecified role bait bait physical association physical association 5D tap1-bnl2a-3 4 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Replacement of the 4 cysteine residues by alanine did not change the interaction 13 unspecified role unspecified role bait bait physical association physical association 5D tapbp-bnl2a-2 4 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Replacement of the 4 cysteine residues by alanine did not change the interaction physical association physical association 5D tap1-bnl2a-7 5 10 ancillary ancillary unspecified role unspecified role nucl transfection nucleic acid transfection nucl transfection 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Replacement of the 4 cysteine residues by alanine did not change the interaction 13 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association 5D tap2-bnl2a-3 5 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Replacement of the 4 cysteine residues by alanine did not change the interaction 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association 5D tapbp-bnl2a-6 5 10 ancillary ancillary unspecified role unspecified role nucl transfection nucleic acid transfection nucl transfection 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Replacement of the 4 cysteine residues by alanine did not change the interaction physical association physical association 5D tap2-bnl2a-4 8 10 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Replacement of the 4 cysteine residues by alanine did not change the interaction physical association physical association 5D tap1-bnl2a-5 8 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Replacement of the 4 cysteine residues by alanine did not change the interaction 13 unspecified role unspecified role bait bait physical association physical association 5D bnl2a-canx 6 9 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization 7B tapbp-bnl2a-8 2 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey infection infection Replacement of the 4 cysteine residues by alanine did not change the interaction association association 7C tap2-bnl2a-6 2 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey infection infection Replacement of the 4 cysteine residues by alanine did not change the interaction 10 unspecified role unspecified role bait bait association association 7C tap1-bnl2a-8 2 13 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey infection infection Replacement of the 4 cysteine residues by alanine did not change the interaction physical association physical association 7C bnl2a-canx-1 6 13 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization 7Bi tap1-tap2 7 13 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey association association 3A tap2-tap1 7 11 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association 3A tapbp-bnl2a-5 7 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey association association 3A