IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The structure of the BIR3 domain of cIAP1 in complex with the N-terminal peptides of SMAC and caspase-9. The structure of the BIR3 domain of cIAP1 in complex with the N-terminal peptides of SMAC and caspase-9. Acta Crystallogr. D Biol. Crystallogr. (0907-4449) 2009 imex curation Kulathila R., Vash B., Sage D., Cornell-Kennon S., Wright K., Koehn J., Stams T., Clark K., Price A. priceal@emmanuel.edu 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kulathila R., Vash B., Sage D., Cornell-Kennon S., Wright K., Koehn J., Stams T., Clark K., Price A. In the materials and methods section the authors define the cIAP1/BIRC2 construct used for crystallization as residues 250-352, however based on the data deposited in pdb and further discussion in the publication, the used construct maps to residues 260-352 of cIAP1/BIRC2. priceal@emmanuel.edu Accepted 2014-JAN-30 by PPORRAS Acta Crystallogr. D Biol. Crystallogr. (0907-4449) 2009 Only protein-protein interactions imex curation The structure of the BIR3 domain of cIAP1 in complex with the N-terminal peptides of SMAC and caspase-9. The structure of the BIR3 domain of cIAP1 in complex with the N-terminal peptides of SMAC and caspase-9. Acta Crystallogr. D Biol. Crystallogr. (0907-4449) 2009 imex curation Kulathila R., Vash B., Sage D., Cornell-Kennon S., Wright K., Koehn J., Stams T., Clark K., Price A. priceal@emmanuel.edu 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kulathila R., Vash B., Sage D., Cornell-Kennon S., Wright K., Koehn J., Stams T., Clark K., Price A. priceal@emmanuel.edu Accepted 2014-JAN-30 by PPORRAS Acta Crystallogr. D Biol. Crystallogr. (0907-4449) 2009 Only protein-protein interactions imex curation birc2_human Baculoviral IAP repeat-containing protein 2 Inhibitor of apoptosis protein 2 TNFR2-TRAF-signaling complex protein 2 IAP homolog B RING finger protein 48 BIRC2 API1 MIHB RNF48 RING-type E3 ubiquitin transferase BIRC2 Cellular inhibitor of apoptosis 1 protein protein human Homo sapiens Human MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLSTSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTTGENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS C1778D328063586D dbloh_human Diablo homolog, mitochondrial Second mitochondria-derived activator of caspase Direct IAP-binding protein with low pI DIABLO SMAC protein protein human Homo sapiens Human MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED 70C2AE0DC654D031 casp9_human Caspase-9 ICE-like apoptotic protease 6 Apoptotic protease Mch-6 Apoptotic protease-activating factor 3 CASP9 MCH6 protein protein human Homo sapiens Human MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS DIP protein P55211 original sequence version: 174 DIP protein P55211 original sequence version: 167 DIP protein P55211 original sequence version: 124 DIP protein P55211 original sequence version: 125 DIP protein P55211 original sequence version: 123 DIP protein P55211 original sequence version: 153 78E0180DF2A3BDD2 birc2-casp9-3 2 5 unspecified role unspecified role prey prey lig_bir_iii_2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role bait bait bir domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobd Escherichia coli (strain B / BL21-DE3) 10 8 direct interaction direct interaction Fig. 1 Temp = 25C; pH = 7.4 birc2-diablo-3 2 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role bait bait bir domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobd Escherichia coli (strain B / BL21-DE3) 16 14 direct interaction direct interaction Fig. 1 Temp = 25C; pH = 7.4 birc2-casp9-4 1 3 unspecified role unspecified role neutral component neutral component bir domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gpgs-tag n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobd Escherichia coli (strain B / BL21-DE3) 5 unspecified role unspecified role neutral component neutral component lig_bir_iii_2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 23 20 direct interaction direct interaction Table 1 1.50A working 18.3%, free 20.5% birc2-diablo-4 1 3 unspecified role unspecified role neutral component neutral component bir domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gpgs-tag n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobd Escherichia coli (strain B / BL21-DE3) 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 29 26 direct interaction direct interaction Table 1 2.30A working 20.1%, free 25.6%