IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Brd4 coactivates transcriptional activation of NF-kappaB via specific binding to acetylated RelA. Brd4 coactivates transcriptional activation of NF-kappaB via specific binding to acetylated RelA. Mol. Cell. Biol. (0270-7306) 2009 imex curation Huang B., Yang X.D., Zhou M.M., Ozato K., Chen L.F. IBD - Inflammatory bowel disease In the mean time the corresponding author replied to my query about recombinant RelA, confirming human origin; is there a general expression system for 'insect cells'? His reply about the expression system wasn't very specific... Expression constructs for human RelA are described in PMID:12456660. The human origin of recombinant RelA was confirmed by the corresponding author by e-mail, while its purification is described in PMID:16111893. Expression constructs for mouse Brd4 are described in PMID:16109376. The origin of mouse p300 was derived from PMID:11114158 and PMID:11509661. lfchen@life.uiuc.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Huang B., Yang X.D., Zhou M.M., Ozato K., Chen L.F. IBD - Inflammatory bowel disease In the mean time the corresponding author replied to my query about recombinant RelA, confirming human origin; is there a general expression system for 'insect cells'? His reply about the expression system wasn't very specific... Expression constructs for human RelA are described in PMID:12456660. The human origin of recombinant RelA was confirmed by the corresponding author by e-mail, while its purification is described in PMID:16111893. Expression constructs for mouse Brd4 are described in PMID:16109376. The origin of mouse p300 was derived from PMID:11114158 and PMID:11509661. lfchen@life.uiuc.edu Accepted 2015-JAN-26 by ORCHARD Mol. Cell. Biol. (0270-7306) 2009 Only protein-protein interactions imex curation Brd4 coactivates transcriptional activation of NF-kappaB via specific binding to acetylated RelA. Brd4 coactivates transcriptional activation of NF-kappaB via specific binding to acetylated RelA. Mol. Cell. Biol. (0270-7306) 2009 imex curation Huang B., Yang X.D., Zhou M.M., Ozato K., Chen L.F. IBD - Inflammatory bowel disease In the mean time the corresponding author replied to my query about recombinant RelA, confirming human origin; is there a general expression system for 'insect cells'? His reply about the expression system wasn't very specific... Expression constructs for human RelA are described in PMID:12456660. The human origin of recombinant RelA was confirmed by the corresponding author by e-mail, while its purification is described in PMID:16111893. Expression constructs for mouse Brd4 are described in PMID:16109376. The origin of mouse p300 was derived from PMID:11114158 and PMID:11509661. lfchen@life.uiuc.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Huang B., Yang X.D., Zhou M.M., Ozato K., Chen L.F. IBD - Inflammatory bowel disease In the mean time the corresponding author replied to my query about recombinant RelA, confirming human origin; is there a general expression system for 'insect cells'? His reply about the expression system wasn't very specific... Expression constructs for human RelA are described in PMID:12456660. The human origin of recombinant RelA was confirmed by the corresponding author by e-mail, while its purification is described in PMID:16111893. Expression constructs for mouse Brd4 are described in PMID:16109376. The origin of mouse p300 was derived from PMID:11114158 and PMID:11509661. lfchen@life.uiuc.edu Accepted 2015-JAN-26 by ORCHARD Mol. Cell. Biol. (0270-7306) 2009 Only protein-protein interactions imex curation Brd4 coactivates transcriptional activation of NF-kappaB via specific binding to acetylated RelA. Brd4 coactivates transcriptional activation of NF-kappaB via specific binding to acetylated RelA. Mol. Cell. Biol. (0270-7306) 2009 imex curation Huang B., Yang X.D., Zhou M.M., Ozato K., Chen L.F. IBD - Inflammatory bowel disease In the mean time the corresponding author replied to my query about recombinant RelA, confirming human origin; is there a general expression system for 'insect cells'? His reply about the expression system wasn't very specific... Expression constructs for human RelA are described in PMID:12456660. The human origin of recombinant RelA was confirmed by the corresponding author by e-mail, while its purification is described in PMID:16111893. Expression constructs for mouse Brd4 are described in PMID:16109376. The origin of mouse p300 was derived from PMID:11114158 and PMID:11509661. lfchen@life.uiuc.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Huang B., Yang X.D., Zhou M.M., Ozato K., Chen L.F. IBD - Inflammatory bowel disease In the mean time the corresponding author replied to my query about recombinant RelA, confirming human origin; is there a general expression system for 'insect cells'? His reply about the expression system wasn't very specific... Expression constructs for human RelA are described in PMID:12456660. The human origin of recombinant RelA was confirmed by the corresponding author by e-mail, while its purification is described in PMID:16111893. Expression constructs for mouse Brd4 are described in PMID:16109376. The origin of mouse p300 was derived from PMID:11114158 and PMID:11509661. lfchen@life.uiuc.edu Accepted 2015-JAN-26 by ORCHARD Mol. Cell. Biol. (0270-7306) 2009 Only protein-protein interactions imex curation Brd4 coactivates transcriptional activation of NF-kappaB via specific binding to acetylated RelA. Brd4 coactivates transcriptional activation of NF-kappaB via specific binding to acetylated RelA. Mol. Cell. Biol. (0270-7306) 2009 imex curation Huang B., Yang X.D., Zhou M.M., Ozato K., Chen L.F. IBD - Inflammatory bowel disease In the mean time the corresponding author replied to my query about recombinant RelA, confirming human origin; is there a general expression system for 'insect cells'? His reply about the expression system wasn't very specific... Expression constructs for human RelA are described in PMID:12456660. The human origin of recombinant RelA was confirmed by the corresponding author by e-mail, while its purification is described in PMID:16111893. Expression constructs for mouse Brd4 are described in PMID:16109376. The origin of mouse p300 was derived from PMID:11114158 and PMID:11509661. lfchen@life.uiuc.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Huang B., Yang X.D., Zhou M.M., Ozato K., Chen L.F. IBD - Inflammatory bowel disease In the mean time the corresponding author replied to my query about recombinant RelA, confirming human origin; is there a general expression system for 'insect cells'? His reply about the expression system wasn't very specific... Expression constructs for human RelA are described in PMID:12456660. The human origin of recombinant RelA was confirmed by the corresponding author by e-mail, while its purification is described in PMID:16111893. Expression constructs for mouse Brd4 are described in PMID:16109376. The origin of mouse p300 was derived from PMID:11114158 and PMID:11509661. lfchen@life.uiuc.edu Accepted 2015-JAN-26 by ORCHARD Mol. Cell. Biol. (0270-7306) 2009 Only protein-protein interactions imex curation Brd4 coactivates transcriptional activation of NF-kappaB via specific binding to acetylated RelA. Brd4 coactivates transcriptional activation of NF-kappaB via specific binding to acetylated RelA. Mol. Cell. Biol. (0270-7306) 2009 imex curation Huang B., Yang X.D., Zhou M.M., Ozato K., Chen L.F. IBD - Inflammatory bowel disease In the mean time the corresponding author replied to my query about recombinant RelA, confirming human origin; is there a general expression system for 'insect cells'? His reply about the expression system wasn't very specific... Expression constructs for human RelA are described in PMID:12456660. The human origin of recombinant RelA was confirmed by the corresponding author by e-mail, while its purification is described in PMID:16111893. Expression constructs for mouse Brd4 are described in PMID:16109376. The origin of mouse p300 was derived from PMID:11114158 and PMID:11509661. lfchen@life.uiuc.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Huang B., Yang X.D., Zhou M.M., Ozato K., Chen L.F. IBD - Inflammatory bowel disease In the mean time the corresponding author replied to my query about recombinant RelA, confirming human origin; is there a general expression system for 'insect cells'? His reply about the expression system wasn't very specific... Expression constructs for human RelA are described in PMID:12456660. The human origin of recombinant RelA was confirmed by the corresponding author by e-mail, while its purification is described in PMID:16111893. Expression constructs for mouse Brd4 are described in PMID:16109376. The origin of mouse p300 was derived from PMID:11114158 and PMID:11509661. lfchen@life.uiuc.edu Accepted 2015-JAN-26 by ORCHARD Mol. Cell. Biol. (0270-7306) 2009 Only protein-protein interactions imex curation Brd4 coactivates transcriptional activation of NF-kappaB via specific binding to acetylated RelA. Brd4 coactivates transcriptional activation of NF-kappaB via specific binding to acetylated RelA. Mol. Cell. Biol. (0270-7306) 2009 imex curation Huang B., Yang X.D., Zhou M.M., Ozato K., Chen L.F. IBD - Inflammatory bowel disease In the mean time the corresponding author replied to my query about recombinant RelA, confirming human origin; is there a general expression system for 'insect cells'? His reply about the expression system wasn't very specific... Expression constructs for human RelA are described in PMID:12456660. The human origin of recombinant RelA was confirmed by the corresponding author by e-mail, while its purification is described in PMID:16111893. Expression constructs for mouse Brd4 are described in PMID:16109376. The origin of mouse p300 was derived from PMID:11114158 and PMID:11509661. lfchen@life.uiuc.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Huang B., Yang X.D., Zhou M.M., Ozato K., Chen L.F. IBD - Inflammatory bowel disease In the mean time the corresponding author replied to my query about recombinant RelA, confirming human origin; is there a general expression system for 'insect cells'? His reply about the expression system wasn't very specific... RelA-deficient mouse embryonic fibroblasts were reconstituted with either wild-type or Lys310Arg mutant RelA. Expression constructs for human RelA are described in PMID:12456660. The human origin of recombinant RelA was confirmed by the corresponding author by e-mail, while its purification is described in PMID:16111893. Expression constructs for mouse Brd4 are described in PMID:16109376. The origin of mouse p300 was derived from PMID:11114158 and PMID:11509661. lfchen@life.uiuc.edu Accepted 2015-JAN-26 by ORCHARD Mol. Cell. Biol. (0270-7306) 2009 Only protein-protein interactions imex curation Brd4 coactivates transcriptional activation of NF-kappaB via specific binding to acetylated RelA. Brd4 coactivates transcriptional activation of NF-kappaB via specific binding to acetylated RelA. Mol. Cell. Biol. (0270-7306) 2009 imex curation Huang B., Yang X.D., Zhou M.M., Ozato K., Chen L.F. IBD - Inflammatory bowel disease In the mean time the corresponding author replied to my query about recombinant RelA, confirming human origin; is there a general expression system for 'insect cells'? His reply about the expression system wasn't very specific... Expression constructs for human RelA are described in PMID:12456660. The human origin of recombinant RelA was confirmed by the corresponding author by e-mail, while its purification is described in PMID:16111893. Expression constructs for mouse Brd4 are described in PMID:16109376. The origin of mouse p300 was derived from PMID:11114158 and PMID:11509661. lfchen@life.uiuc.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Huang B., Yang X.D., Zhou M.M., Ozato K., Chen L.F. IBD - Inflammatory bowel disease In the mean time the corresponding author replied to my query about recombinant RelA, confirming human origin; is there a general expression system for 'insect cells'? His reply about the expression system wasn't very specific... Expression constructs for human RelA are described in PMID:12456660. The human origin of recombinant RelA was confirmed by the corresponding author by e-mail, while its purification is described in PMID:16111893. Expression constructs for mouse Brd4 are described in PMID:16109376. The origin of mouse p300 was derived from PMID:11114158 and PMID:11509661. lfchen@life.uiuc.edu Accepted 2015-JAN-26 by ORCHARD Mol. Cell. Biol. (0270-7306) 2009 Only protein-protein interactions imex curation ep300_human Histone acetyltransferase p300 Histone butyryltransferase p300 Histone crotonyltransferase p300 Protein propionyltransferase p300 EP300 P300 E1A-associated protein p300 Protein 2-hydroxyisobutyryltransferase p300 Protein lactyltransferas p300 protein protein human Homo sapiens Human MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMPNMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQNPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPSLPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPIPGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQRMQHHMQQMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH DIP protein Q09472 original sequence version: 193 DIP protein Q09472 original sequence version: 186 DIP protein Q09472 original sequence version: 107 DIP protein Q09472 original sequence version: 112 DIP protein Q09472 original sequence version: 181 DIP protein Q09472 original sequence version: 183 DIP protein Q09472 original sequence version: 136 DIP protein Q09472 original sequence version: 146 DIP protein Q09472 original sequence version: 165 DIP protein Q09472 original sequence version: 192 DIP protein Q09472 original sequence version: 200 DIP protein Q09472 original sequence version: 206 DIP protein Q09472 original sequence version: 194 DIP protein Q09472 original sequence version: 171 DIP protein Q09472 original sequence version: 142 DIP protein Q09472 original sequence version: 180 8E869E1F174A6FEB tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 brd4_mouse Bromodomain-containing protein 4 Mcap Mitotic chromosome-associated protein Brd4 protein protein mouse Mus musculus Mouse MSTESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRGRGRKETGAAKPGVSTVPNTTQASTSPQTQTPQQNPPPPVQATTHPFPAVTPDLIAQPPVMTMVPPQPLQTPSPVPPQPPPPPAPVPQPVQSHPPIIATTPQPVKTKKGVKRKADTTTPTTIDPIHEPPSLAPEPKTAKLGPRRESSRPVKPPKKDVPDSQQHPGPEKSSKISEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLESREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVTVSSPAVPPPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKEKDKKEKKKEKHKKKEEVEENKKSKTKELPPKKTKKNNSSNSNVSKKEPVPTKTKPPPTYESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESTSESSSSDSEDSETEMAPKSKKKGHTGRDQKKHHHHHHPQMQPAPAPVPQQPPPPPQQPPPPPPPQQQQQQPPPPPPPPSMPQQTAPAMKSSPPPFITAQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLPQPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPTRPPAVSPALAQPPLLPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPPPPHPSVQQQQLQPQPPPPPPPQPQPPPQQQHQPPPRPVHLPSMPFSAHIQQPPPPPGQQPTHPPPGQQPPPPQPAKPQQVIQHHPSPRHHKSDPYSAGHLREAPSPLMIHSPQMPQFQSLTHQSPPQQNVQPKKQVKGRAEPQPPGPVMGQGQGCPPASPAAVPMLSQELRPPSVVQPQPLVVVKEEKIHSPIIRSEPFSTSLRPEPPKHPENIKAPVHLPQRPEMKPVDIGRPVIRPPEQSAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMGSWASLVQKHPTTPSSTAKSSSDSFEHFRRAAREKEEREKALKAQAEHAEKEKERLRQERMRSREDEDALEQARRAHEEARRRQEQQQQQQQQRQEQQQQQQQAAAVAAASAPQAQSSQPQSMLDQQRELARKREQERRRREAMAATIDMNFQSDLLSIFEENLF DIP protein Q9ESU6 original sequence version: 119 3D90F6D3254D5691 ep300_mouse Histone acetyltransferase p300 Histone butyryltransferase p300 Histone crotonyltransferase p300 Protein propionyltransferase p300 Ep300 P300 E1A-associated protein p300 Protein 2-hydroxyisobutyryltransferase p300 Protein lactyltransferas p300 protein protein mouse Mus musculus Mouse MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQAMASQAQQNSPGLSLINSMVKSPMAQTGLTSPNMGIGSSGPNQGPTQSPAGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRPNMQYPNAGMGNAGSLLTEPLQQGSPQMGGQPGLRGPQPLKMGMMNNPSPYGSPYTQNSGQQIGASGLGLQIQTKTVLPNNLSPFAMDKKAVPGGGMPSMGQQPTPSVQQPGLVTPVAAGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQSILTGAPVGLGNPSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQIPPQPQVQAKNQQSQPSGQSPQGMRSVNNMSASPMGVNGGVGVQTPNLLSDSMLHSTINSQNPMMSENAGVASLGPLPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAPGMGPVPMNTGSNMGQQPTGMTTNGPVPDPSMIRGSVPNHMMPRMTPQPGLNQFGQMNMPQPPIGPRQPSPLQHHGQLAQSGSLNPPMGYGPRMQQASGQNQFLSQTQFTSQGMNVTNMPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPTLPQQAHQNSPSPVPSRTPTPHHTPPSIGNQPPPATAIPTPVPTPPAIPPGPQPPSLHPSSRQTPTPPTHLPPQVQPSLPAAPSADQSQQQPRSQQSTAVSVPTPTAPLLPPQPSTPLSQPAVSIEGQVSNPPSTSSTEVNSQTIPEKQPSQEVKMESKMEVDKPEPADAQPEDTKEAKGEDVKVEPTEMEERGPELKTDGKEEEEQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYIDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPSGFVCDGCLKKTARTRKENKLSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIACPAPNSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVAGQQQGLPSPTPATPTTPTGQQPATPQTPQPQPTSQPQPTPPNNMTPYLPRTQTTGPVSQGKAPGQVTPPTPPQTAQAPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMSPMAPMGMNPPPMARGPGGHLDPGIGPAGMQQQPPWAQGGMPQPQQMQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANPNPQPLPGQPGMTQGQPGLQPPTMPGQQGVHSNPALQNMNPLQAGVQRAGLPQQQPQQQLQPPMGAMSPQAQQMNMNHNTMPSQFRDILRRQMMQQQGAGPGIGPGMANQFQQPQGIGYPPQQQQQQRMQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQAANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSSDNADLNSNLSQSTLDIH DIP protein B2RWS6 original sequence version: 53 DIP protein B2RWS6 original sequence version: 73 DIP protein B2RWS6 original sequence version: 79 0E9B2D9508237671 tnap3_human_gene Tumor necrosis factor alpha-induced protein 3 (TNFAIP3) human gene gene gene human Homo sapiens Human lyam2_mouse_gene E-selectin (Sele) mouse gene gene gene mouse Mus musculus Mouse cdk9_mouse Cyclin-dependent kinase 9 Cdk9 Cell division protein kinase 9 protein protein mouse Mus musculus Mouse MAKQYDSVECPFCDEVTKYEKLAKIGQGTFGEVFKAKHRQTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDKYELFEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF DIP protein Q99J95 original sequence version: 57 973B18869F9963E3 rpb1_mouse DNA-directed RNA polymerase II subunit RPB1 Polr2a Rpii215 Rpo2-1 DNA-directed RNA polymerase II subunit A DNA-directed RNA polymerase III largest subunit protein protein mouse Mus musculus Mouse MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPASPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN DIP protein P08775 original sequence version: 94 DIP protein P08775 original sequence version: 114 DIP protein P08775 original sequence version: 110 DIP protein P08775 original sequence version: 123 7D76F38FD92A657E lyam2_human_gene E-selectin (SELE) human gene gene gene human Homo sapiens Human tnfa_human_gene Tumor necrosis factor TNF TNFA TNFSF2 Cachectin TNF-alpha Tumor necrosis factor ligand superfamily member 2 gene gene human Homo sapiens Human brd4_human Bromodomain-containing protein 4 Protein HUNK1 BRD4 HUNK1 protein protein human Homo sapiens Human MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRGRGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMTVVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTIDPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKEKDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETEMAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPPPPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLPQPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLLPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPPPPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPPHPPPGQQPPPPQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMGSWASLVQKHPTTPSSTAKSSSDSFEQFRRAAREKEEREKALKAQAEHAEKEKERLRQERMRSREDEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSMLDQQRELARKREQERRRREAMAATIDMNFQSDLLSIFEENLF D52EFE1CF9960907 brd4-rela-5 4 9 unspecified role unspecified role prey prey possible acetyllys-310 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait bromodomain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range bromodomain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Fig. 1b GST fusion constructs containing both Brd4 bromodomains pulled down more acetylated RelA compared to constructs containing the single bromodomains. rela-brd4-2 1 10 unspecified role unspecified role prey prey n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range bromodomain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain bromodomain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain possible acetyllys-310 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain n-terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Fig. 1a rela-brd4-3 2 9 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association Fig. 1e Tumor necrosis factor alpha (TNF-alpha) brd4-rela-7 5 10 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined possible acetyllys-310 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1d mouse p300 (B2RWS6) Co-transfection of mouse p300 (B2RWS6), but not mouse p300 lacking the catalytic HAT domain, results in Brd4 co-precipitating more acetylated RelA and total RelA. rela-tnf 3 17 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait possible acetyllys-310 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain association association Fig. 3c, 3d Tumor necrosis factor alpha (TNF-alpha) brd4-tnf 3 18 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 3c, 3d Tumor necrosis factor alpha (TNF-alpha) O60885 increases expression at RNA level of ENSG00000204490 ep300-tnf 3 8 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 3c, 3d Tumor necrosis factor alpha (TNF-alpha) rela-lyam2 3 9 unspecified role unspecified role bait bait possible acetyllys-310 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain 16 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 3c, 3d Tumor necrosis factor alpha (TNF-alpha) Q04206 increases expression at RNA level of ENSG00000007908 brd4-lyam2 3 18 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 3c, 3d Tumor necrosis factor alpha (TNF-alpha) O60885 increases expression at RNA level of ENSG00000007908 ep300-lyam2 3 8 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 3c, 3d Tumor necrosis factor alpha (TNF-alpha) rela-tnap3 3 9 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 3c, 3d Tumor necrosis factor alpha (TNF-alpha) brd4-rela-8 7 9 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q04206:p.Lys310Arg mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R Wed May 02 17:13:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys310arg' Tue Jun 30 18:07:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys310Arg' 10 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 4a mouse p300 (B2RWS6) Co-transfection of mouse p300 (B2RWS6) results in Brd4 co-precipitating more T7-tagged RelA. rela-lyam2-1 6 9 unspecified role unspecified role bait bait possible acetyllys-310 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4b, 6a Tumor necrosis factor alpha (TNF-alpha) brd4-lyam2-1 6 13 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait association association Fig. 4b, 6a Tumor necrosis factor alpha (TNF-alpha) human RelA (Q04206) acetylated at lys310 The interaction occurred in mouse embryonic fibroblasts reconstituted with wild-type but not lys310arg mutant RelA. ep300-lyam2-1 6 13 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait association association Fig. 4b, 6a Tumor necrosis factor alpha (TNF-alpha) cdk9-lyam2 6 14 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 6a Tumor necrosis factor alpha (TNF-alpha) human RelA (Q04206) acetylated at lys310 The interaction occurred in mouse embryonic fibroblasts reconstituted with wild-type but not lys310arg mutant RelA. polr2a-lyam2 6 13 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait possible phosphoser opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 6a Tumor necrosis factor alpha (TNF-alpha) E-selectin promoter DNA co-precipitated with anti-Pol II antibody from MEFs reconstituted with wild-type or lys310arg mutant RelA; however, co-precipitation with anti-phospho-Pol II antibody was only observed in MEFs reconstituted with wild-type but not lys310arg mutant RelA. brd4-rela-9 4 9 unspecified role unspecified role prey prey required acetyllys-310 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait bromodomain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig. 1c, 5a brd4-rela-10 7 10 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range bromodomain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5b mouse p300 (B2RWS6) Co-transfection of mouse p300 (B2RWS6) results in Brd4 co-precipitating more T7-tagged RelA.