bhf-ucl The regulation of the cardiac potassium channel (HERG) by caveolin-1. The regulation of the cardiac potassium channel (HERG) by caveolin-1. Biochem. Cell Biol. (0829-8211) 2008 imex curation Lin J., Lin S., Choy P.C., Shen X., Deng C., Kuang S., Wu J., Xu W. annotated human KCNH2 in y2h expts based on introductory statement: the human ether-a-go-go related gene (herg) is a human homolog to the Dros ether-a-go-go gene, the reverse primer is complementary to the human C-terminal sequence GGCTCGGACCCGGGCAGTTAG, but not to that of rat or mouse and the human protein is the length described in the paper 1159aa sheguanglin@yahoo.cn 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Lin J., Lin S., Choy P.C., Shen X., Deng C., Kuang S., Wu J., Xu W. annotated human KCNH2 in y2h expts based on introductory statement: the human ether-a-go-go related gene (herg) is a human homolog to the Dros ether-a-go-go gene, the reverse primer is complementary to the human C-terminal sequence GGCTCGGACCCGGGCAGTTAG, but not to that of rat or mouse and the human protein is the length described in the paper 1159aa sheguanglin@yahoo.cn Accepted 2014-DEC-17 by ORCHARD Biochem. Cell Biol. (0829-8211) 2008 Only protein-protein interactions imex curation The regulation of the cardiac potassium channel (HERG) by caveolin-1. The regulation of the cardiac potassium channel (HERG) by caveolin-1. Biochem. Cell Biol. (0829-8211) 2008 imex curation Lin J., Lin S., Choy P.C., Shen X., Deng C., Kuang S., Wu J., Xu W. annotated human KCNH2 in y2h expts based on introductory statement: the human ether-a-go-go related gene (herg) is a human homolog to the Dros ether-a-go-go gene, the reverse primer is complementary to the human C-terminal sequence GGCTCGGACCCGGGCAGTTAG, but not to that of rat or mouse and the human protein is the length described in the paper 1159aa sheguanglin@yahoo.cn 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lin J., Lin S., Choy P.C., Shen X., Deng C., Kuang S., Wu J., Xu W. annotated human KCNH2 in y2h expts based on introductory statement: the human ether-a-go-go related gene (herg) is a human homolog to the Dros ether-a-go-go gene, the reverse primer is complementary to the human C-terminal sequence GGCTCGGACCCGGGCAGTTAG, but not to that of rat or mouse and the human protein is the length described in the paper 1159aa sheguanglin@yahoo.cn Accepted 2014-DEC-17 by ORCHARD human heart cDNA library (Clontech) Biochem. Cell Biol. (0829-8211) 2008 Only protein-protein interactions imex curation The regulation of the cardiac potassium channel (HERG) by caveolin-1. The regulation of the cardiac potassium channel (HERG) by caveolin-1. Biochem. Cell Biol. (0829-8211) 2008 imex curation Lin J., Lin S., Choy P.C., Shen X., Deng C., Kuang S., Wu J., Xu W. annotated human KCNH2 in y2h expts based on introductory statement: the human ether-a-go-go related gene (herg) is a human homolog to the Dros ether-a-go-go gene, the reverse primer is complementary to the human C-terminal sequence GGCTCGGACCCGGGCAGTTAG, but not to that of rat or mouse and the human protein is the length described in the paper 1159aa sheguanglin@yahoo.cn 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Lin J., Lin S., Choy P.C., Shen X., Deng C., Kuang S., Wu J., Xu W. annotated human KCNH2 in y2h expts based on introductory statement: the human ether-a-go-go related gene (herg) is a human homolog to the Dros ether-a-go-go gene, the reverse primer is complementary to the human C-terminal sequence GGCTCGGACCCGGGCAGTTAG, but not to that of rat or mouse and the human protein is the length described in the paper 1159aa sheguanglin@yahoo.cn Accepted 2014-DEC-17 by ORCHARD Biochem. Cell Biol. (0829-8211) 2008 Only protein-protein interactions imex curation The regulation of the cardiac potassium channel (HERG) by caveolin-1. The regulation of the cardiac potassium channel (HERG) by caveolin-1. Biochem. Cell Biol. (0829-8211) 2008 imex curation Lin J., Lin S., Choy P.C., Shen X., Deng C., Kuang S., Wu J., Xu W. annotated human KCNH2 in y2h expts based on introductory statement: the human ether-a-go-go related gene (herg) is a human homolog to the Dros ether-a-go-go gene, the reverse primer is complementary to the human C-terminal sequence GGCTCGGACCCGGGCAGTTAG, but not to that of rat or mouse and the human protein is the length described in the paper 1159aa sheguanglin@yahoo.cn 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lin J., Lin S., Choy P.C., Shen X., Deng C., Kuang S., Wu J., Xu W. annotated human KCNH2 in y2h expts based on introductory statement: the human ether-a-go-go related gene (herg) is a human homolog to the Dros ether-a-go-go gene, the reverse primer is complementary to the human C-terminal sequence GGCTCGGACCCGGGCAGTTAG, but not to that of rat or mouse and the human protein is the length described in the paper 1159aa sheguanglin@yahoo.cn Accepted 2014-DEC-17 by ORCHARD human heart cDNA library (Clontech) Biochem. Cell Biol. (0829-8211) 2008 Only protein-protein interactions imex curation cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI DIP protein Q03135 original sequence version: 164 DIP protein Q03135 original sequence version: 119 DIP protein Q03135 original sequence version: 122 DIP protein Q03135-1 original sequence version: 122 DIP protein Q03135 original sequence version: 133 DIP protein Q03135 original sequence version: 155 DIP protein Q03135 original sequence version: 147 2424DE9B5E6521D5 kcnh2_rat Potassium voltage-gated channel subfamily H member 2 Kcnh2 Erg Ether-a-go-go-related gene potassium channel 1 Voltage-gated potassium channel subunit Kv11.1 protein protein rat Rattus norvegicus (Rat) Rat MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEKDMVGSPAHDTNHRGPSTSWLASGRAKTFRLKLPALLALTARESPMRTGSTGSPGAPGAVVVDVDLTPAAPSSESLALDEVSAMDNHVAGLGPAEERRALVGPASASPVASIPGPHPSPRAQSLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMRAGALPLPPRHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDREIIAPKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLKETEDGSQAPDCGYACQPLAVVDLLVDIMFIVDILINFRTTYVNANEEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMDSHIGWLHNLGDQIGKPYNSSGLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALYFISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPSSAELESGFNRQRKRKLSFRRRTDKDTEQPGEVSALGQGPARVGPGPSCRGQPGGPWGESPSSGPSSPESSEDEGPGRSSSPLRLVPFSSPRPPGDSPGGEPLTEDGEKSSDTCNPLSGAFSGVSNIFSFWGDSRGRQYQELPRCPAPAPSLLNIPLSSPGRRSRGDVESRLDALQRQLNRLETRLSADMATVLQLLQRQMTLVPPAYSAVTTPGPGPTSTSPLLPVGPVPTLTLDSLSQVSQFVAFEELPAGAPELPQDGPTRRLSLPGQLGALTSQPLHRHGSDPGS F0D75B0B532D9EA2 cav1_rat Caveolin-1 Cav1 Cav protein protein rat Rattus norvegicus (Rat) Rat MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQEEI 55E8F6ABC7514FD2 kcnh2_human Potassium voltage-gated channel subfamily H member 2 Voltage-gated potassium channel subunit Kv11.1 Ether-a-go-go-related gene potassium channel 1 Eag homolog KCNH2 ERG ERG1 HERG protein protein human Homo sapiens Human MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEKDMVGSPAHDTNHRGPPTSWLAPGRAKTFRLKLPALLALTARESSVRSGGAGGAGAPGAVVVDVDLTPAAPSSESLALDEVTAMDNHVAGLGPAEERRALVGPGSPPRSAPGQLPSPRAHSLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMRAGVLPPPPRHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDREIIAPKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLKETEEGPPATECGYACQPLAVVDLIVDIMFIVDILINFRTTYVNANEEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMDSRIGWLHNLGDQIGKPYNSSGLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALYFISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPGSTELEGGFSRQRKRKLSFRRRTDKDTEQPGEVSALGPGRAGAGPSSRGRPGGPWGESPSSGPSSPESSEDEGPGRSSSPLRLVPFSSPRPPGEPPGGEPLMEDCEKSSDTCNPLSGAFSGVSNIFSFWGDSRGRQYQELPRCPAPTPSLLNIPLSSPGRRPRGDVESRLDALQRQLNRLETRLSADMATVLQLLQRQMTLVPPAYSAVTTPGPGPTSTSPLLPVSPLPTLTLDSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS D03BD4F657641FBA kcnh2-cav1 2 HERG 8 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey physical association physical association Results section 2 cav1-kcnh2-1 3 6 polyclonal western polyclonal antibody western blot polyclonal western polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role prey prey cell lysate cell lysate 7 polyclonal western polyclonal antibody western blot polyclonal western polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role bait bait cell lysate cell lysate physical association physical association Fig 1 cav1-kcnh2-2 1 5 immunocytochemistry immunocytochemistry polyclonal immunost polyclonal antibody immunostaining polyclonal immunost unspecified role unspecified role neutral component neutral component fixed cell fixed cell 8 immunocytochemistry immunocytochemistry polyclonal immunost polyclonal antibody immunostaining polyclonal immunost unspecified role unspecified role neutral component neutral component fixed cell fixed cell colocalization colocalization Fig 2 kcnh2-cav1-3 4 HERG 8 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain described by authors as oligomerization domain 23 26 physical association physical association Table 3 kcnh2-cav1-3 4 HERG 8 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain described by authors as oligomerization domain 29 32 physical association physical association Table 3 kcnh2-cav1-3 4 HERG 8 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain described by authors as oligomerization domain 35 39 physical association physical association Table 3