HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Ubiquitination and proteasomal degradation of interferon regulatory factor-3 induced by Npro from a cytopathic bovine viral diarrhea virus. Ubiquitination and proteasomal degradation of interferon regulatory factor-3 induced by Npro from a cytopathic bovine viral diarrhea virus. Virology (0042-6822) 2007 imex curation Chen Z., Rijnbrand R., Jangra R.K., Devaraj S.G., Qu L., Ma Y., Lemon S.M., Li K. Virus - Publications including interactions involving viral proteins kuli@utmb.edu 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions bovin-mdbk Bos taurus mdbk Madin-Darby bovine kidney cells anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Chen Z., Rijnbrand R., Jangra R.K., Devaraj S.G., Qu L., Ma Y., Lemon S.M., Li K. Virus - Publications including interactions involving viral proteins kuli@utmb.edu Accepted 2014-JUN-26 by MGT Virology (0042-6822) 2007 Only protein-protein interactions imex curation Ubiquitination and proteasomal degradation of interferon regulatory factor-3 induced by Npro from a cytopathic bovine viral diarrhea virus. Ubiquitination and proteasomal degradation of interferon regulatory factor-3 induced by Npro from a cytopathic bovine viral diarrhea virus. Virology (0042-6822) 2007 imex curation Chen Z., Rijnbrand R., Jangra R.K., Devaraj S.G., Qu L., Ma Y., Lemon S.M., Li K. Virus - Publications including interactions involving viral proteins kuli@utmb.edu 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Chen Z., Rijnbrand R., Jangra R.K., Devaraj S.G., Qu L., Ma Y., Lemon S.M., Li K. Virus - Publications including interactions involving viral proteins kuli@utmb.edu Accepted 2014-JUN-26 by MGT Virology (0042-6822) 2007 Only protein-protein interactions imex curation irf3_bovin Interferon regulatory factor 3 IRF3 protein protein bovin Bos taurus (Bovine) Bovine MGTQKPRILPWLISQLDRGELEGVAWLGESRTRFRIPWKHGLRQDAQQEDFGIFQAWAVASGAYTPGKDKPDLPTWKRNFRSALNRKEVLRLAEDHSKDSQDPHKIYEFVNSGVRDIPEPDTSQDNGRHNTSDTQEDTLEKLLSDMDLSPGGPSNLTMASEKPPQFLQSPDSDIPALCPNSGLSENPLKQLLANEEDWEFEVTAFYRGCQVFQQTVFCPGGLRLVGSEAGDRMLPGQPIRLPDPATSLTDKSVTDYVQRVLSCLGGGLALWRAGQWLCAQRLGHCHVYWAIGEELLPSCGHKPDGEVPKDREGGVFNLGPFITDLITFIEGSRRSPLYTLWFCVGQSWPQDQPWIKRLVMVKVVPMCLRVLVDIARQGGASSLENTVDLHISNSDPLSLTPDQYMACLQDLAEDMDF 06ADC5BCCD4D6389 p19711-pro_0000038024 N-terminal protease protein protein bvdvn Bovine viral diarrhea virus (isolate NADL) MELITNELLYKTYKQKPVGVEEPVYDQAGDPLFGERGAVHPQSTLKLPHKRGERDVPTNLASLPKRGDCRSGNSRGPVSGIYLKPGPLFYQDYKGPVYHRAPLELFEEGSMCETTKRIGRVTGSDGKLYHIYVCIDGCIIIKSATRSYQRVFRWVHNRLDCPLWVTTC 1 168 239A6EA207D485BA irf3_human Interferon regulatory factor 3 IRF3 protein protein human Homo sapiens Human MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGES DIP protein Q14653 original sequence version: 96 DIP protein Q14653 original sequence version: 75 DIP protein Q14653 original sequence version: 95 DIP protein Q14653-1 original sequence version: 128 DIP protein Q14653 original sequence version: 119 F536676FA78B0110 npro-irf3 2 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 8 Interaction happens when cells are treated with proteasome inhibitors, MG115 or epoxomicin. In figure 8A and 8C, Npro-29 and Npro-25 cells were used, respectively. npro-irf3-1 1 4 unspecified role unspecified role prey prey n terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role bait bait physical association physical association 8B The L8P mutant, which is incapable of inducing IRF-3 ubiquitination, can also interact with IRF-3. Epoxomicin -a Proteasome inhibitor.