IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Three-dimensional structure of I(to); Kv4.2-KChIP2 ion channels by electron microscopy at 21 Angstrom resolution. Three-dimensional structure of I(to); Kv4.2-KChIP2 ion channels by electron microscopy at 21 Angstrom resolution. Neuron (0896-6273) 2004 imex curation Kim L.A., Furst J., Gutierrez D., Butler M.H., Xu S., Goldstein S.A., Grigorieff N. Cardiac - Interactions involving cardiac related proteins 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Kim L.A., Furst J., Gutierrez D., Butler M.H., Xu S., Goldstein S.A., Grigorieff N. Cardiac - Interactions involving cardiac related proteins Accepted 2014-OCT-08 by ORCHARD Neuron (0896-6273) 2004 imex curation kcnd2_human Potassium voltage-gated channel subfamily D member 2 KCND2 KIAA1044 Voltage-gated potassium channel subunit Kv4.2 protein protein human Homo sapiens Human MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLERYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELAFFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDTAGESALPTMTARQRVWRAFENPHTSTMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIFTVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAAFWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL 0C11E62FFA220421 kcip2_human Kv channel-interacting protein 2 Cardiac voltage-gated potassium channel modulatory subunit A-type potassium channel modulatory protein 2 Potassium channel-interacting protein 2 KCNIP2 KCHIP2 protein protein human Homo sapiens Human MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSETLAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI B75AD02B9E273243 kcnd2-kcnip2 1 3 unspecified role unspecified role neutral component neutral component chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 2 unspecified role unspecified role neutral component neutral component c-terminus rho tag rho tag 1D4 tag rho1D4 tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range information about the position of the tag was found in Kim LA et al., 2003 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 The particular isoform has been engineered to contain a pore-binding site for the peptide charybdotoxin (CTX). physical association physical association Fig. 1 21A kcnd2-kcnip2-1 1 2 unspecified role unspecified role neutral component neutral component c-terminus rho tag rho tag 1D4 tag rho1D4 tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range information about the position of the tag was found in Kim LA et al., 2003 n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 The particular isoform has been engineered to contain a pore-binding site for the peptide charybdotoxin (CTX). 3 unspecified role unspecified role neutral component neutral component chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association Fig. 3C, D