UniProt UniProt http://www.uniprot.org Identification and purification of two distinct complexes containing the five RAD51 paralogs. Identification and purification of two distinct complexes containing the five RAD51 paralogs. Genes Dev. (0890-9369) 2001 imex curation Masson J.Y., Tarsounas M.C., Stasiak A.Z., Stasiak A., Shah R., McIlwraith M.J., Benson F.E., West S.C. s.west@icrf.icnet.uk 02-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection electrophoresis electrophoretic mobility-based method electrophoresis weight by comassie molecular weight estimation by coomasie staining weight by comassie Masson J.Y., Tarsounas M.C., Stasiak A.Z., Stasiak A., Shah R., McIlwraith M.J., Benson F.E., West S.C. s.west@icrf.icnet.uk Accepted 2014-MAR-17 by MGT Genes Dev. (0890-9369) 2001 Only protein-protein interactions imex curation Identification and purification of two distinct complexes containing the five RAD51 paralogs. Identification and purification of two distinct complexes containing the five RAD51 paralogs. Genes Dev. (0890-9369) 2001 imex curation Masson J.Y., Tarsounas M.C., Stasiak A.Z., Stasiak A., Shah R., McIlwraith M.J., Benson F.E., West S.C. s.west@icrf.icnet.uk 02-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection electrophoresis electrophoretic mobility-based method electrophoresis western blot western blot Immuno blot Immuno blot Masson J.Y., Tarsounas M.C., Stasiak A.Z., Stasiak A., Shah R., McIlwraith M.J., Benson F.E., West S.C. s.west@icrf.icnet.uk Accepted 2014-MAR-17 by MGT Genes Dev. (0890-9369) 2001 Only protein-protein interactions imex curation Identification and purification of two distinct complexes containing the five RAD51 paralogs. Identification and purification of two distinct complexes containing the five RAD51 paralogs. Genes Dev. (0890-9369) 2001 imex curation Masson J.Y., Tarsounas M.C., Stasiak A.Z., Stasiak A., Shah R., McIlwraith M.J., Benson F.E., West S.C. s.west@icrf.icnet.uk 02-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Masson J.Y., Tarsounas M.C., Stasiak A.Z., Stasiak A., Shah R., McIlwraith M.J., Benson F.E., West S.C. s.west@icrf.icnet.uk Accepted 2014-MAR-17 by MGT Genes Dev. (0890-9369) 2001 Only protein-protein interactions imex curation Identification and purification of two distinct complexes containing the five RAD51 paralogs. Identification and purification of two distinct complexes containing the five RAD51 paralogs. Genes Dev. (0890-9369) 2001 imex curation Masson J.Y., Tarsounas M.C., Stasiak A.Z., Stasiak A., Shah R., McIlwraith M.J., Benson F.E., West S.C. s.west@icrf.icnet.uk 02-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection pull down pull down western blot western blot Immuno blot Immuno blot Masson J.Y., Tarsounas M.C., Stasiak A.Z., Stasiak A., Shah R., McIlwraith M.J., Benson F.E., West S.C. s.west@icrf.icnet.uk Accepted 2014-MAR-17 by MGT Genes Dev. (0890-9369) 2001 Only protein-protein interactions imex curation Identification and purification of two distinct complexes containing the five RAD51 paralogs. Identification and purification of two distinct complexes containing the five RAD51 paralogs. Genes Dev. (0890-9369) 2001 imex curation Masson J.Y., Tarsounas M.C., Stasiak A.Z., Stasiak A., Shah R., McIlwraith M.J., Benson F.E., West S.C. s.west@icrf.icnet.uk 02-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Masson J.Y., Tarsounas M.C., Stasiak A.Z., Stasiak A., Shah R., McIlwraith M.J., Benson F.E., West S.C. s.west@icrf.icnet.uk Accepted 2014-MAR-17 by MGT Genes Dev. (0890-9369) 2001 Only protein-protein interactions imex curation xrcc2_human DNA repair protein XRCC2 XRCC2 X-ray repair cross-complementing protein 2 protein protein human Homo sapiens Human MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYCLGRFFLVYCSSSTHLLLTLYSLESMFCSHPSLCLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFATTQTIMQKASSSSEEPSHASRRLCDVDIDYRPYLCKAWQQLVKHRMFFSKQDDSQSSNQFSLVSRCLKSNSLKKHFFIIGESGVEFC DIP protein O43543 original sequence version: 105 5656277E74C06074 ra51b_human DNA repair protein RAD51 homolog 2 RAD51L1 RAD51B REC2 RAD51 homolog B RAD51-like protein 1 protein protein human Homo sapiens Human MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF DIP protein O15315 original sequence version: 118 DB0B9AE82F44A52B ra51c_human DNA repair protein RAD51 homolog 3 RAD51 homolog C RAD51C RAD51L2 RAD51-like protein 2 protein protein human Homo sapiens Human MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQLCMQLAVDVQIPECFGGVAGEAVFIDTEGSFMVDRVVDLATACIQHLQLIAEKHKGEEHRKALEDFTLDNILSHIYYFRCRDYTELLAQVYLLPDFLSEHSKVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKIDRNQALLVPALGESWGHAATIRLIFHWDRKQRLATLYKSPSQKECTVLFQIKPQGFRDTVVTSACSLQTEGSLSTRKRSRDPEEEL DIP protein O43502 original sequence version: 118 3AAADD3C1C0851E0 ra51d_human DNA repair protein RAD51 homolog 4 R51H3 RAD51-like protein 3 TRAD RAD51D RAD51L3 RAD51 homolog D protein protein human Homo sapiens Human MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCMAANVAHGLQQNVLYVDSNGGLTASRLLQLLQAKTQDEEEQAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVTGSSGTVKVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHITRDRDSGRLKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSRQPTGFQEMVDIGTWGTSEQSATLQGDQT DIP protein O75771 original sequence version: 130 6038DA9356DF354A xrcc3_human DNA repair protein XRCC3 XRCC3 X-ray repair cross-complementing protein 3 protein protein human Homo sapiens Human MDLDLLDLNPRIIAAIKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLLRTASLHLRGSSILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDVPGELLQKLRFGSQIFIEHVADVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAPRARHLQSLGATLRELSSAFQSPVLCINQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADRLREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH DIP protein O43542 original sequence version: 119 4DDF3B163C3B3332 rad51d-rad51b 5 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association 1 xrcc3-rad51c 4 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 rad51c-xrcc3 3 8 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3 rad51b-rad51c 3 8 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection 9 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection 6 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection physical association physical association 3 rad51c-rad51b 4 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 4A rad51c-rad51d 4 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 4B rad51c-rad51b-1 4 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 9 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection association association 4C rad51d-rad51b-1 1 8 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection 7 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection physical association physical association 5A BCDX2 complex rad51d-rad51b-2 2 8 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection 7 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection physical association physical association 5B rad51c-xrcc3-1 1 8 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection physical association physical association 5C