UniProt UniProt http://www.uniprot.org Human Cdc34 and Rad6B ubiquitin-conjugating enzymes target repressors of cyclic AMP-induced transcription for proteolysis. Human Cdc34 and Rad6B ubiquitin-conjugating enzymes target repressors of cyclic AMP-induced transcription for proteolysis. Mol. Cell. Biol. (0270-7306) 1999 imex curation Pati D., Meistrich M.L., Plon S.E. splon@bcm.tmc.edu 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pati D., Meistrich M.L., Plon S.E. splon@bcm.tmc.edu Accepted 2014-NOV-10 by ORCHARD Mol. Cell. Biol. (0270-7306) 1999 Only protein-protein interactions imex curation q03060-11 cAMP-responsive element modulator CREM 2beta-b IcerHIbeta ICERIIgamma CREM Inducible cAMP early repressor protein protein human Homo sapiens Human MAVTGDDTAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY Produced by alternative splicing of isoform 6. Repressor. E1B2CC0E4E59F383 ub2r1_human Ubiquitin-conjugating enzyme E2 R1 Ubiquitin-protein ligase R1 Ubiquitin-conjugating enzyme E2-32 kDa complementing Ubiquitin-conjugating enzyme E2-CDC34 CDC34 UBE2R1 UBCH3 (E3-independent) E2 ubiquitin-conjugating enzyme R1 E2 ubiquitin-conjugating enzyme R1 protein protein human Homo sapiens Human MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES DIP protein P49427 original sequence version: 101 DIP protein P49427 original sequence version: 134 258960666B589DB3 atf5_human Cyclic AMP-dependent transcription factor ATF-5 Activating transcription factor 5 Transcription factor ATFx ATF5 ATFX protein protein human Homo sapiens Human MSLLATLGLELDRALLPASGLGWLVDYGKLPPAPAPLAPYEVLGGALEGGLPVGGEPLAGDGFSDWMTERVDFTALLPLEPPLPPGTLPQPSPTPPDLEAMASLLKKELEQMEDFFLDAPPLPPPSPPPLPPPPLPPAPSLPLSLPSFDLPQPPVLDTLDLLAIYCRNEAGQEEVGMPPLPPPQQPPPPSPPQPSRLAPYPHPATTRGDRKQKKRDQNKSAALRYRQRKRAEGEALEGECQGLEARNRELKERAESVEREIQYVKDLLIEVYKARSQRTRSC DDB2F907CA0215A0 cdc34-crem 1 3 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey physical association physical association cdc34-atf5 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association