UniProt UniProt http://www.uniprot.org Genetic, biochemical, and crystallographic characterization of Fhit-substrate complexes as the active signaling form of Fhit. Genetic, biochemical, and crystallographic characterization of Fhit-substrate complexes as the active signaling form of Fhit. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1998 imex curation Pace H.C., Garrison P.N., Robinson A.K., Barnes L.D., Draganescu A., Rösler A., Blackburn G.M., Siprashvili Z., Croce C.M., Huebner K., Brenner C. brenner@dada.jci.tju.edu 27-Mar-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pace H.C., Garrison P.N., Robinson A.K., Barnes L.D., Draganescu A., Rösler A., Blackburn G.M., Siprashvili Z., Croce C.M., Huebner K., Brenner C. brenner@dada.jci.tju.edu Accepted 2013-FEB-28 by ORCHARD 27-Mar-2013: Contacted by IntAct-Help. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1998 Only protein-protein interactions imex curation fhit_human Bis(5'-adenosyl)-triphosphatase Diadenosine 5',5'''-P1,P3-triphosphate hydrolase Dinucleosidetriphosphatase AP3A hydrolase Fragile histidine triad protein FHIT Adenosine 5'-monophosphoramidase FHIT Adenylylsulfatase Adenylylsulfate-ammonia adenylyltransferase protein protein human Homo sapiens Human MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ DIP protein P49789 original sequence version: 79 14D85961A19ECF3E fhit-1 1 2 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction 3.10 A for 1FHI; 2.60 A for 2FHI R-factor: 0.241 R-free: 0.314 for 1FHI; R-factor: 0.241 R-free: 0.278 for 2FHI Fig. 2