IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Clarification of the dimerization domain and its functional significance for the Escherichia coli nucleoid protein H-NS. Clarification of the dimerization domain and its functional significance for the Escherichia coli nucleoid protein H-NS. J. Mol. Biol. (0022-2836) 1997 imex curation Ueguchi C., Seto C., Suzuki T., Mizuno T. crosslinking agent was dimethyl suberimidate. 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions ecoli Escherichia coli (strain K12) electrophoresis electrophoretic mobility-based method electrophoresis western blot western blot Immuno blot Immuno blot Ueguchi C., Seto C., Suzuki T., Mizuno T. crosslinking agent was dimethyl suberimidate. Accepted 2013-JUN-26 by MGT 02-Aug-2013: Contacted by IntAct-Help. J. Mol. Biol. (0022-2836) 1997 Only protein-protein interactions imex curation Clarification of the dimerization domain and its functional significance for the Escherichia coli nucleoid protein H-NS. Clarification of the dimerization domain and its functional significance for the Escherichia coli nucleoid protein H-NS. J. Mol. Biol. (0022-2836) 1997 imex curation Ueguchi C., Seto C., Suzuki T., Mizuno T. crosslinking agent was dimethyl suberimidate. 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Ueguchi C., Seto C., Suzuki T., Mizuno T. crosslinking agent was dimethyl suberimidate. Accepted 2013-JUN-26 by MGT 02-Aug-2013: Contacted by IntAct-Help. J. Mol. Biol. (0022-2836) 1997 Only protein-protein interactions imex curation hns_ecoli DNA-binding protein H-NS hns bglY cur drdX hnsA msyA osmZ pilG topS b1237 Histone-like protein HLP-II Protein H1 Protein B1 JW1225 Heat-stable nucleoid-structuring protein protein protein ecoli Escherichia coli (strain K12) MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ DIP protein P0ACF8 original sequence version: 44 E628184AC7C86F49 hns-1 2 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0ACF8:p.Leu30Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L P Wed May 02 18:17:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu30pro' Tue Jun 30 16:57:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu30Pro' P0ACF8:p.Leu30Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L D Wed May 02 14:48:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu30asp' Tue Jun 30 20:24:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu30Asp' ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Fig. 3, 4, 5 hns-2 1 3 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Fig. 3 lane 3