HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html The N-terminal region of hepatitis C virus nonstructural protein 3 (NS3) is essential for stable complex formation with NS4A. The N-terminal region of hepatitis C virus nonstructural protein 3 (NS3) is essential for stable complex formation with NS4A. J. Virol. (0022-538X) 1995 imex curation Satoh S., Tanji Y., Hijikata M., Kimura K., Shimotohno K. kshimoto@gan.ncc.go.jp 09-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Satoh S., Tanji Y., Hijikata M., Kimura K., Shimotohno K. kshimoto@gan.ncc.go.jp Accepted 2013-AUG-07 by ORCHARD 09-Aug-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 1995 imex curation The N-terminal region of hepatitis C virus nonstructural protein 3 (NS3) is essential for stable complex formation with NS4A. The N-terminal region of hepatitis C virus nonstructural protein 3 (NS3) is essential for stable complex formation with NS4A. J. Virol. (0022-538X) 1995 imex curation Satoh S., Tanji Y., Hijikata M., Kimura K., Shimotohno K. kshimoto@gan.ncc.go.jp 09-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Satoh S., Tanji Y., Hijikata M., Kimura K., Shimotohno K. kshimoto@gan.ncc.go.jp Accepted 2013-AUG-07 by ORCHARD 09-Aug-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 1995 imex curation p27958-pro_0000037574 Non-structural protein 4A protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) STWVLVGGVLAALAAYCLSTGCVVIVGRIVLSGKPAIIPDREVLYQEFDEMEEC 1658 1711 527EC748BC450589 p27958-pro_0000037573 Serine protease/helicase NS3 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQTYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPTGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAKGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADAGCSGGAYDIIICDECHSTDATSISGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVSTDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELTPAETTVRLRAYMNTPGLPVCQDHLGFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMRKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEVVT 1027 1657 5601AD5882D04C8F ns3-ns4a-14 2 NS3 4 unspecified role unspecified role bait bait tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain NS4A 3 unspecified role unspecified role prey prey tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 2A and 5 ns3-ns4a-15 2 NS3 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain NS4A 3 unspecified role unspecified role bait bait tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 2A and 5 ns3-ns4a-16 2 NS3 4 unspecified role unspecified role prey prey c-terminal dhfr tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain NS4A 3 unspecified role unspecified role bait bait tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 2B and 3 ns3-ns4a-17 1 NS3 4 unspecified role unspecified role bait bait tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal dhfr tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS4A 3 unspecified role unspecified role prey prey tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 2A and 5