MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Fluorescence Resonance Energy Transfer Based on Interaction of PII and PipX Proteins Provides a Robust and Specific Biosensor for 2-Oxoglutarate, a Central Metabolite and a Signaling Molecule. Fluorescence Resonance Energy Transfer Based on Interaction of PII and PipX Proteins Provides a Robust and Specific Biosensor for 2-Oxoglutarate, a Central Metabolite and a Signaling Molecule. FEBS J. (1742-464X) 2013 imex curation Chen H.L., Bernard C.S., Hubert P., My L., Zhang C.C. cbernard@imm.cnrs.fr 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence cbernard@imm.cnrs.fr Accepted 2013-DEC-20 by LUANA 2013 imex curation q8yzh5_noss1 asr0485 protein protein noss1 Nostoc sp. (strain PCC 7120 / UTEX 2576) MNPENSETYINHPTWGLLYRICMVDESQDLFTTLYAQRLFFLVGNDIKAIKFQPIGRTEARMLLENRLRNLRRNGQSQEYDQLQSVFQRTFQ C178ABB35C21ABD4 q9l422_noss1 Nitrogen regulatory protein P-II PII signal transducing protein glnB protein protein noss1 Nostoc sp. (strain PCC 7120 / UTEX 2576) MKKVEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKVEIVVEDNQVDMVVDKIIAAARTGEIGDGKIFISPVEQVIRIRTGEKNTEAV F74E54C38B67596B glnb-q8yzh5 1 PipX 2 tag fluorescence tag visualisation by fluorescence tag fluorescence tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role fluorescence donor fluorescence donor purified purified cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PII 3 tag fluorescence tag visualisation by fluorescence tag fluorescence tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9L422:p.[Thr52Pro;Glu54Pro] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T P certain certain sequence position certain certain certain sequence position certain E P Wed May 02 19:26:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr52pro,glu54pro' Tue Jun 30 17:11:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr52Pro;Glu54Pro]' direct interaction direct interaction f2 f3a f3b f3c f3d f3e f3f f4 f5 sf1 glnb-q8yzh5-1 1 PII 3 tag fluorescence tag visualisation by fluorescence tag fluorescence tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role fluorescence donor fluorescence donor purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PipX 2 tag fluorescence tag visualisation by fluorescence tag fluorescence tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f2 glnb-q8yzh5-2 1 PipX 2 tag fluorescence tag visualisation by fluorescence tag fluorescence tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role fluorescence donor fluorescence donor purified purified Q8YZH5:p.[Tyr35Pro;Gln37Pro] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y P certain certain sequence position certain certain certain sequence position certain Q P Wed May 02 14:47:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr35pro,gln37pro' Tue Jun 30 19:22:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr35Pro;Gln37Pro]' his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PII 3 tag fluorescence tag visualisation by fluorescence tag fluorescence tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f2 f3a f3b f3c f3d f3e f3f f4 f5 sf1