Molecular Connections Molecular Connections Pvt. Ltd. 2/2, Kariappa Road, Basavanagudi, Bangalore -560 004 www.molecularconnections.com Human tumor necrosis factor (TNF)-alpha-induced protein 8-like 2 suppresses hepatocellular carcinoma metastasis through inhibiting Rac1. Human tumor necrosis factor (TNF)-alpha-induced protein 8-like 2 suppresses hepatocellular carcinoma metastasis through inhibiting Rac1. Mol. Cancer 2013 imex curation Cao X., Zhang L., Shi Y., Sun Y., Dai S., Guo C., Zhu F., Wang Q., Wang J., Wang X., Chen Y.H., Zhang L. Cancer - Interactions investigated in the context of cancer zhanglining@sdu.edu.cn 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions Molecular Connections Pvt. ltd. human-bel-7402 Human BEL-7402 Hepatoma cell line bel-7402 BEL-7402 Human Hepatoma cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cao X., Zhang L., Shi Y., Sun Y., Dai S., Guo C., Zhu F., Wang Q., Wang J., Wang X., Chen Y.H., Zhang L. Cancer - Interactions investigated in the context of cancer Details on mutations in TIPE2 affecting the binding are not curated as it is not clear from the article if mutations at Lys15, Lys16 and Arg24 are individual mutations or complex mutations. zhanglining@s du.edu.cn zhanglining@sdu.edu.cn Accepted 2013-DEC-20 by PPORRAS Mol. Cancer 2013 imex curation Molecular Connections Pvt. ltd. Human tumor necrosis factor (TNF)-alpha-induced protein 8-like 2 suppresses hepatocellular carcinoma metastasis through inhibiting Rac1. Human tumor necrosis factor (TNF)-alpha-induced protein 8-like 2 suppresses hepatocellular carcinoma metastasis through inhibiting Rac1. Mol. Cancer 2013 imex curation Cao X., Zhang L., Shi Y., Sun Y., Dai S., Guo C., Zhu F., Wang Q., Wang J., Wang X., Chen Y.H., Zhang L. Cancer - Interactions investigated in the context of cancer zhanglining@sdu.edu.cn 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions Molecular Connections Pvt. ltd. human-thp-1 Homo sapiens acute monocytic leukemia cells thp-1 Human acute monocytic leukemia cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cao X., Zhang L., Shi Y., Sun Y., Dai S., Guo C., Zhu F., Wang Q., Wang J., Wang X., Chen Y.H., Zhang L. Cancer - Interactions investigated in the context of cancer zhanglining@s du.edu.cn zhanglining@sdu.edu.cn Accepted 2013-DEC-20 by PPORRAS Mol. Cancer 2013 imex curation Molecular Connections Pvt. ltd. tp8l2_human Tumor necrosis factor alpha-induced protein 8-like protein 2 TNFAIP8L2 Inflammation factor protein 20 protein protein human Homo sapiens Human MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL DIP protein Q6P589 original sequence version: 80 D76EAEF5E24D3895 rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL ACEDF83A45E5EA67 tnfaip8l2-rac1 1 3 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range The mutant TNFAIP8L2 in which the N-terminal Lys or Arg residues, Lys-15, Lys-16, and Arg-24 are replaced with Glu or Ala fail to bind. 4 unspecified role unspecified role prey prey physical association physical association 4b rac1-tnfaip8l2 2 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association s4b