MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structure, biochemical characterization and analysis of the pleomorphism of carboxylesterase Cest-2923 from Lactobacillus plantarum WCFS1 Structure, biochemical characterization and analysis of the pleomorphism of carboxylesterase Cest-2923 from Lactobacillus plantarum WCFS1 FEBS J. (1742-464X) 2013 imex curation Benavente R., Esteban-Torres M., Acebrón I., de Las Rivas B., Muñoz R., Alvarez Y., Mancheño J.M. xjosemi@iqfr.csic.es 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Benavente R., Esteban-Torres M., Acebrón I., de Las Rivas B., Muñoz R., Alvarez Y., Mancheño J.M. xjosemi@iqfr.csic.es Accepted 2013-OCT-15 by MARTA 22-Nov-2013: Contacted by IntAct-Help. FEBS J. (1742-464X) 2013 Only protein-protein interactions imex curation Structure, biochemical characterization and analysis of the pleomorphism of carboxylesterase Cest-2923 from Lactobacillus plantarum WCFS1 Structure, biochemical characterization and analysis of the pleomorphism of carboxylesterase Cest-2923 from Lactobacillus plantarum WCFS1 FEBS J. (1742-464X) 2013 imex curation Benavente R., Esteban-Torres M., Acebrón I., de Las Rivas B., Muñoz R., Alvarez Y., Mancheño J.M. xjosemi@iqfr.csic.es 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Benavente R., Esteban-Torres M., Acebrón I., de Las Rivas B., Muñoz R., Alvarez Y., Mancheño J.M. xjosemi@iqfr.csic.es Accepted 2013-OCT-15 by MARTA 22-Nov-2013: Contacted by IntAct-Help. FEBS J. (1742-464X) 2013 Only protein-protein interactions imex curation f9us10_lacpl lp_2923 protein protein lacpl Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) MQVEQRTLNTAAHPFQITAYWLDQISDFETAVDYPIMIICPGGGFTYHSGREEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQAMLQHQVATAYHLFGSGIHGLALANHVTQKPGKDKYLNDQAAIWPQLALRWLQEQGLLAGNY FA8717CA1728CB18 f9us10 2 Cest-2923 3 unspecified role unspecified role neutral component neutral component purified purified tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction t1 f2 f3 f4 Combining the results derived from these two distinct experimental approaches (crystallographic and analytical ultracentrifugation) we can deduce that Cest-2923 behaves in solution as an associative system well described by two equilibria, namely, a fast equilibrium between species with molecular masses consistent with monomers and dimers and another, much faster one between dimeric and tetrameric species, and secondly that the crystallization process is an active player in selecting a preexisting oligomeric form: dimers at neutral conditions, tetramers at acidic ones. f9us10-1 2 Cest-2923 3 unspecified role unspecified role neutral component neutral component purified purified tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction t1 f4b Combining the results derived from these two distinct experimental approaches (crystallographic and analytical ultracentrifugation) we can deduce that Cest-2923 behaves in solution as an associative system well described by two equilibria, namely, a fast equilibrium between species with molecular masses consistent with monomers and dimers and another, much faster one between dimeric and tetrameric species, and secondly that the crystallization process is an active player in selecting a preexisting oligomeric form: dimers at neutral conditions, tetramers at acidic ones. f9us10-1 1 Cest-2923 3 unspecified role unspecified role neutral component neutral component purified purified tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction f5 sf3 Combining the results derived from these two distinct experimental approaches (crystallographic and analytical ultracentrifugation) we can deduce that Cest-2923 behaves in solution as an associative system well described by two equilibria, namely, a fast equilibrium between species with molecular masses consistent with monomers and dimers and another, much faster one between dimeric and tetrameric species, and secondly that the crystallization process is an active player in selecting a preexisting oligomeric form: dimers at neutral conditions, tetramers at acidic ones. f9us10-1 1 Cest-2923 3 unspecified role unspecified role neutral component neutral component purified purified tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction f5 sf3 Combining the results derived from these two distinct experimental approaches (crystallographic and analytical ultracentrifugation) we can deduce that Cest-2923 behaves in solution as an associative system well described by two equilibria, namely, a fast equilibrium between species with molecular masses consistent with monomers and dimers and another, much faster one between dimeric and tetrameric species, and secondly that the crystallization process is an active player in selecting a preexisting oligomeric form: dimers at neutral conditions, tetramers at acidic ones.