MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Triose phosphate isomerase from the blood fluke Schistosoma mansoni: biochemical characterisation of a potential drug and vaccine target Triose phosphate isomerase from the blood fluke Schistosoma mansoni: biochemical characterisation of a potential drug and vaccine target FEBS Lett. (0014-5793) 2013 imex curation Zinsser V.L., Farnell E., Dunne D.W., Timson D.J. d.timson@qub.ac.uk 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight by staining molecular weight estimation by staining weight by staining Zinsser V.L., Farnell E., Dunne D.W., Timson D.J. d.timson@qub.ac.uk Accepted 2013-SEP-16 by LPERFETTO 14-Oct-2013: Contacted by IntAct-Help. FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation Triose phosphate isomerase from the blood fluke Schistosoma mansoni: biochemical characterisation of a potential drug and vaccine target Triose phosphate isomerase from the blood fluke Schistosoma mansoni: biochemical characterisation of a potential drug and vaccine target FEBS Lett. (0014-5793) 2013 imex curation Zinsser V.L., Farnell E., Dunne D.W., Timson D.J. d.timson@qub.ac.uk 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Zinsser V.L., Farnell E., Dunne D.W., Timson D.J. d.timson@qub.ac.uk Accepted 2013-SEP-16 by LPERFETTO 14-Oct-2013: Contacted by IntAct-Help. FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation g4v6b9_schma Triosephosphate isomerase protein protein schma Schistosoma mansoni (Blood fluke) Blood fluke MSGSRKFFVGGNWKMNGSRDDNDKLLKLLSEAHFDDNTEVLIAPPSVFLHEIRKSLKKEIHVAAQNCYKVSKGAFTGEISPAMIKDIGCDWVILGHSERRNIFGESDELIAEKVQHALAEGLSVIACIGETLSERESNKTEEVCVRQLKAIANKIKSADEWKRVVVAYEPVWAIGTGKVATPQQAQEVHNFLRKWFKTNAPNGVDEKIRIIYGGSVTAANCKELAQQHDVDGFLVGGASLKPEFTEICKARQR A3AE3DF9B3818688 g4v6b9 1 SmTPI 3 unspecified role unspecified role unspecified role unspecified role purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction f1b g4v6b9-1 2 SmTPI 3 unspecified role unspecified role unspecified role unspecified role ecoli Escherichia coli (strain K12) direct interaction direct interaction f1c