IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ GPR3 Stimulates Aβ Production via Interactions with APP and β-Arrestin2. GPR3 Stimulates Aβ Production via Interactions with APP and β-Arrestin2. PLoS ONE 2013 imex curation Nelson C.D., Sheng M. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease FLAG -Arrestins - the Data -proc Ref 28 was the only paper which gave ANY info for the arrestins - most of the rest were review articles... SweAPP-HEK cells - 293 cells transfected with "Swedish" APP695 - ( UniProt P05067-4) with naturally occurring mutations K670N and M671L. Flag tagged arrestins have been entered as Human on the basis of pmid:12582207 - Reference 28. RJ Lefkowitz-donor of the contructs is last author. sheng.morgan@gene.com 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Nelson C.D., Sheng M. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. FLAG -Arrestins - the Data -proc Ref 28 was the only paper which gave ANY info for the arrestins - most of the rest were review articles... SweAPP-HEK cells - 293 cells transfected with "Swedish" APP695 - ( UniProt P05067-4) with naturally occurring mutations K670N and M671L. Flag tagged arrestins have been entered as Human on the basis of pmid:12582207 - Reference 28. RJ Lefkowitz-donor of the contructs is last author. sheng.morgan@gene.com Accepted 2013-DEC-17 by PPORRAS PLoS ONE 2013 imex curation GPR3 Stimulates Aβ Production via Interactions with APP and β-Arrestin2. GPR3 Stimulates Aβ Production via Interactions with APP and β-Arrestin2. PLoS ONE 2013 imex curation Nelson C.D., Sheng M. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease FLAG -Arrestins - the Data -proc Ref 28 was the only paper which gave ANY info for the arrestins - most of the rest were review articles... SweAPP-HEK cells - 293 cells transfected with "Swedish" APP695 - ( UniProt P05067-4) with naturally occurring mutations K670N and M671L. Flag tagged arrestins have been entered as Human on the basis of pmid:12582207 - Reference 28. RJ Lefkowitz-donor of the contructs is last author. sheng.morgan@gene.com 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions rat-neuron Rattus norvegicus neuronal cell neuron Neuron [Neuronal cell; Neural cell confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Nelson C.D., Sheng M. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. FLAG -Arrestins - the Data -proc Ref 28 was the only paper which gave ANY info for the arrestins - most of the rest were review articles... SweAPP-HEK cells - 293 cells transfected with "Swedish" APP695 - ( UniProt P05067-4) with naturally occurring mutations K670N and M671L. Flag tagged arrestins have been entered as Human on the basis of pmid:12582207 - Reference 28. RJ Lefkowitz-donor of the contructs is last author. sheng.morgan@gene.com Accepted 2013-DEC-17 by PPORRAS PLoS ONE 2013 imex curation GPR3 Stimulates Aβ Production via Interactions with APP and β-Arrestin2. GPR3 Stimulates Aβ Production via Interactions with APP and β-Arrestin2. PLoS ONE 2013 imex curation Nelson C.D., Sheng M. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease FLAG -Arrestins - the Data -proc Ref 28 was the only paper which gave ANY info for the arrestins - most of the rest were review articles... SweAPP-HEK cells - 293 cells transfected with "Swedish" APP695 - ( UniProt P05067-4) with naturally occurring mutations K670N and M671L. Flag tagged arrestins have been entered as Human on the basis of pmid:12582207 - Reference 28. RJ Lefkowitz-donor of the contructs is last author. sheng.morgan@gene.com 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nelson C.D., Sheng M. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. FLAG -Arrestins - the Data -proc Ref 28 was the only paper which gave ANY info for the arrestins - most of the rest were review articles... SweAPP-HEK cells - 293 cells transfected with "Swedish" APP695 - ( UniProt P05067-4) with naturally occurring mutations K670N and M671L. Flag tagged arrestins have been entered as Human on the basis of pmid:12582207 - Reference 28. RJ Lefkowitz-donor of the contructs is last author. sheng.morgan@gene.com Accepted 2013-DEC-17 by PPORRAS PLoS ONE 2013 imex curation GPR3 Stimulates Aβ Production via Interactions with APP and β-Arrestin2. GPR3 Stimulates Aβ Production via Interactions with APP and β-Arrestin2. PLoS ONE 2013 imex curation Nelson C.D., Sheng M. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease FLAG -Arrestins - the Data -proc Ref 28 was the only paper which gave ANY info for the arrestins - most of the rest were review articles... SweAPP-HEK cells - 293 cells transfected with "Swedish" APP695 - ( UniProt P05067-4) with naturally occurring mutations K670N and M671L. Flag tagged arrestins have been entered as Human on the basis of pmid:12582207 - Reference 28. RJ Lefkowitz-donor of the contructs is last author. sheng.morgan@gene.com 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Nelson C.D., Sheng M. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. FLAG -Arrestins - the Data -proc Ref 28 was the only paper which gave ANY info for the arrestins - most of the rest were review articles... SweAPP-HEK cells - 293 cells transfected with "Swedish" APP695 - ( UniProt P05067-4) with naturally occurring mutations K670N and M671L. Flag tagged arrestins have been entered as Human on the basis of pmid:12582207 - Reference 28. RJ Lefkowitz-donor of the contructs is last author. sheng.morgan@gene.com Accepted 2013-DEC-17 by PPORRAS PLoS ONE 2013 imex curation arrb1_human Beta-arrestin-1 Arrestin beta-1 ARRB1 ARR1 Non-visual arrestin-2 protein protein human Homo sapiens Human MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR DIP protein P49407 original sequence version: 138 DIP protein P49407 original sequence version: 69 DIP protein P49407 original sequence version: 92 DIP protein P49407 original sequence version: 103 0A3C135092338D10 acm1_human Muscarinic acetylcholine receptor M1 CHRM1 protein protein human Homo sapiens Human MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC 567C20F63541C8D0 arrb2_human Beta-arrestin-2 Arrestin beta-2 ARRB2 ARB2 ARR2 Non-visual arrestin-3 protein protein human Homo sapiens Human MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC DIP protein P32121 original sequence version: 148 DIP protein P32121 original sequence version: 102 DIP protein P32121-1 original sequence version: 86 DIP protein P32121-1 original sequence version: 100 DIP protein P32121 original sequence version: 153 DEEC507D4A7B84FF arrb1_rat Beta-arrestin-1 Arrb1 Arrestin beta-1 protein protein rat Rattus norvegicus (Rat) Rat MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPESETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKDEEDDGTGSPHLNNR DIP protein P29066 original sequence version: 70 DIP protein P29066 original sequence version: 90 DIP protein P29066 original sequence version: 79 0A3C07D71B7ABC55 a4_rat Amyloid-beta precursor protein Alzheimer disease amyloid A4 protein homolog ABPP Amyloidogenic glycoprotein App Amyloid precursor protein A4 AD1 Alzheimer disease amyloid protein Amyloid-beta (A4) precursor protein Amyloid-beta A4 protein protein protein rat Rattus norvegicus (Rat) Rat MLPSLALLLLAAWTVRALEVPTDGNAGLLAEPQIAMFCGKLNMHMNVQNGKWESDPSGTKTCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDSIDSADAEEDDSDVWWGGADTDYADGGEDKVVEVAEEEEVADVEEEEAEDDEDVEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSVSSQSLLKTTSEPLPQDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPHHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHPFGVDSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN DIP protein P08592 original sequence version: 136 C26C9D6BB2D929A7 gpr3_human G-protein coupled receptor 3 GPR3 ACCA ACCA orphan receptor protein protein human Homo sapiens Human MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV 0F82E89200968D1E arrb2_rat Beta-arrestin-2 Arrb2 Arrestin beta-2 protein protein rat Rattus norvegicus (Rat) Rat MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPMPNPPRPPTRLQDRLLKKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKSHKRNSVRLIIRKVQFAPETPGPQPSAETTRHFLMSDRRSLHLEASLDKELYYHGEPLNVNVHVTNNSAKTVKKIRVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGQLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHITLPRPQSAPREIDIPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDCDDQFC DIP protein P29067 original sequence version: 115 DIP protein P29067 original sequence version: 112 DIP protein P29067 original sequence version: 100 0DFA6A897C2B86BA pe2r2_human Prostaglandin E2 receptor EP2 subtype PTGER2 Prostanoid EP2 receptor protein protein human Homo sapiens Human MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL B3B0E2AA3CF2E363 p05067-4 Amyloid-beta precursor protein APP A4 AD1 ABPP Alzheimer disease amyloid protein Cerebral vascular amyloid peptide PreA4 Protease nexin-II APPI PreA4 695 Amyloid precursor protein Amyloid-beta A4 protein Alzheimer disease amyloid A4 protein homolog Amyloid-beta (A4) precursor protein protein protein human Homo sapiens Human MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVRVPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN DIP protein P05067-4 original sequence version: 183 DIP protein P05067-4 original sequence version: 198 DIP protein P05067-4 original sequence version: 224 A major isoform. 4F6EA0139F969D56 gpr3-arrb1 3 10 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey c_terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 1A gpr3-arrb1-1 1 10 unspecified role unspecified role bait bait P46089:p.Ser237Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:31:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser237ala' Tue Jun 30 19:23:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser237Ala' P46089:p.[Asp133Ala;Arg134Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain R A Wed May 02 14:33:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp133ala,arg134ala' Tue Jun 30 16:20:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp133Ala;Arg134Ala]' n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range q302* required to bind necessary binding region required to bind range range certain certain sequence position certain 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association 2B, 5Di, 6D. Q302*, a mutant truncated after the seventh transmembrane segment, showed much reduced binding. app-gpr3 2 9 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization 3A/B gpr3-app 3 13 unspecified role unspecified role prey prey lys670asn,met671lys variant variant certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait P46089:p.Ser237Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:04:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser237ala' Tue Jun 30 19:13:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser237Ala' q302* required to bind necessary binding region required to bind range range certain certain sequence position certain n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range P46089:p.[Asp133Ala;Arg134Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:38:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp133ala,arg134ala' Tue Jun 30 18:03:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp133Ala;Arg134Ala]' physical association physical association 4A/C, 5B, 6B, figure 7, Supp fig 3. beta-arrestin2 app-gpr3-1 4 10 unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 13 unspecified role unspecified role bait bait lys670asn,met671lys variant variant certain certain sequence position certain certain certain sequence position certain physical association physical association 4E/F beta-arrestin2 gpr3-app-2 3 12 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 13 unspecified role unspecified role prey prey lys670asn,met671lys variant variant certain certain sequence position certain certain certain sequence position certain physical association physical association 5B, 7 B/E. PGE2 gpr3-arrb1-3 1 12 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association 5Dii ptger2-arrb1 1 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey association association 5Diii, 6D. arrb1-arrb1 1 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association 5Div arrb2-arrb1-1 1 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association 5Dv ptger2-app 3 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey lys670asn,met671lys variant variant certain certain sequence position certain certain certain sequence position certain physical association physical association 6B isoproterenol, beta2 arrestin weak interaction arrb1-arrb1-2 1 11 unspecified role unspecified role prey prey c_terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6Di. isoproterenol gpr3-arrb1-4 3 10 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role prey prey c_terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 1Ai