MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Functional conservation between mammalian MGRN1 and plant LOG2 ubiquitin ligases Functional conservation between mammalian MGRN1 and plant LOG2 ubiquitin ligases FEBS Lett. (0014-5793) 2013 imex curation Guerra D.D., Pratelli R., Kraft E., Callis J., Pilot G. gpilot@vt.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Guerra D.D., Pratelli R., Kraft E., Callis J., Pilot G. gpilot@vt.edu Accepted 2013-SEP-03 by LPERFETTO 30-Sept-2013: Contacted by IntAct-Help. FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation Functional conservation between mammalian MGRN1 and plant LOG2 ubiquitin ligases Functional conservation between mammalian MGRN1 and plant LOG2 ubiquitin ligases FEBS Lett. (0014-5793) 2013 imex curation Guerra D.D., Pratelli R., Kraft E., Callis J., Pilot G. gpilot@vt.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Guerra D.D., Pratelli R., Kraft E., Callis J., Pilot G. gpilot@vt.edu Accepted 2013-SEP-03 by LPERFETTO 30-Sept-2013: Contacted by IntAct-Help. FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation gdu1_arath Protein GLUTAMINE DUMPER 1 GDU1 F28M20.80 At4g31730 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRPLSVQSKFEDVATSTSVNHHGVTPQSPWHSPVPYLFGGLAAMLGLIAFALLILACSYWRLSSSGEEDGQNVDEEKESRSGDKAANGAYEEKFLVIMAGEDLPRYLATPAMKKCTCGGHEGKMVISQEESVAKEEEKMREGEEEKVKDTGETTTTSH 6211B8ABBBA3A695 mgrn1_human E3 ubiquitin-protein ligase MGRN1 MGRN1 KIAA0544 RNF156 Mahogunin RING finger protein 1 RING finger protein 156 RING-type E3 ubiquitin transferase MGRN1 protein protein human Homo sapiens Human MGSILSRRIAGVEDIDIQANSAYRYPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDLNFLGSRPVQFPYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDADSPTEDGDKPRVLYSLEFTFDADARVAITIYCQASEEFLNGRAVYSPKSPSLQSETVHYKRGVSQQFSLPSFKIDFSEWKDDELNFDLDRGVFPVVIQAVVDEGDVVEVTGHAHVLLAAFEKHMDGSFSVKPLKQKQIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTSCADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSPVSFSPVLAQSLEHDEHSCPFKKSKPHPASLASKKPKRETNSDSVPPGYEPISLLEALNGLRAVSPAIPSAPLYEEITYSGISDGLSQASCPLAAIDHILDSSRQKGRPQSKAPDSTLRSPSSPIHEEDEEKLSEDVDAPPPLGGAELALRESSSPESFITEEVDESSSPQQGTRAASIENVLQDSSPEHCGRGPPADIYLPALGPDSCSVGIDE 1F923D25FB49DB4D gdu2_arath Protein GLUTAMINE DUMPER 2 GDU2 F14M19.40 At4g25760 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQTMEGRQYNYQDSINASSSMVVPHSPWHSPVPYLFGGLAAMLALICVALLILACSYWRLSGSAERDLEAGDDAKPDNDTNKTKHTEMPEKFLVIMAGDVRPTYLATPATRSEQSCTCGDHNEEEGRRG A7355B3280DDFF38 gdu5_arath Protein GLUTAMINE DUMPER 5 GDU5 F6A4.130 At5g24920 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRQFPSIRGNINEKMMTTMVESQTRSPWRTPVPYLFGGLAAMLGLIAFALLLLACSYWRLSRQTEDEEKQTESGEKVVAKAFEEKILVIMAGQNNPTFLATPVAAKICLDCVNMEKKEGQNGESKVTEENH F492ED829E802DE1 mgrn1_rat E3 ubiquitin-protein ligase MGRN1 Mgrn1 Mahogunin RING finger protein 1 RING-type E3 ubiquitin transferase MGRN1 protein protein rat Rattus norvegicus (Rat) Rat MGSILSRRIAGVEDIDIQANSAYRYPPKSAGNYFASHFFMGGEKFDTPHPEGYLFGENMDLNFLGSRPVQFPYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDTDSPTEDGEKPRVLYSLEFTFDADARVAITIYCQAVEEFVNGMTVYSCKNPSLQSETVHYKRGVSQQFSLPSFKIDFSEWKDDELNFDLDRGVFPVVIQAVVDEGDVVEVTGHAHVLLAAFEKHVDGSFSVKPLKQKQIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSSECVVCLSDLRDTLILPCRHLCLCTSCADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSPISFSPVLAQSVDHDEHSNSDSVPPGYEPISLLEALNGLRAVSPAIPSAPLYEEITYSGISDGLSQASCPLAGLDRIIENGIQKGKTQSKSPDSTLRSPSSPIHEEDEEKLSEDPEAPLPPSGVELVLQESSSPESFGTEEVGEPSLKQGSRVPSIDDVLQDGSPQHHGCSQPVPPADIYLPALGPESCSVGIEE DC013B16F73D1D1F gdu3_arath Protein GLUTAMINE DUMPER 3 GDU3 LBS1 Protein LESS SUSCEPTIBLE TO BSCTV 1 MRI1.4 At5g57685 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGRQYYPPRENVEGNRTTMGGGPHSPWHSPVPYLFGGLAAMLGLIAFALLILACSYWRLSGYLDGEENQSRERDLEVGDVKPDKTAVKPVALPEKFLVIMAGNVKPTYLATPSVKTCTCDDDDDEDDDVEGSDQVVPRSSESNGETH E0FF8FD1A16A399F gdu7_arath Protein GLUTAMINE DUMPER 7 GDU7 MKD10.70 At5g38770 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLHRDSMVPVNSRLENMDSPILSKICAWGVMLGLFALSLFAMAYACYHKQTSNSCIEEKQGKKQVLKPLDMEPKIVVIMAGNENPTFFAKPTQINA F9BC331DF150103B lofg2_arath Probable E3 ubiquitin-protein ligase LOG2 LOG2 Protein LOSS OF GDU2 RF215 RIG2 RING finger protein 215 F11F8.36 F8A24.18 At3g09770 Probable RING-type E3 ubiquitin transferase LOG2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGNISSSGGEGRRRRRRNHTAAPPPPPPPPSSSLPPPPLPTEIQANPIVFAAVTPYPNPNPNPVYQYPASYYHHPPPGAMPLPPYDHHLQHHPPHPYHNHSWAPVAMARYPYAGHMMAQPTPYVEHQKAVTIRNDVNLKKESLRLEPDPDNPGRFLVSFTFDATVSGRISVIFFAKESEDCKLTATKEDILPPITLDFEKGLGQKFKQSSGSGIDFSVFEDVELFKAAADTEIYPLAVKAEAAPSGGENEEEERSGSKNAQITQAVYEKDKGEIKIRVVKQILWVNGTRYELQEIYGIGNTVEGDDDSADDANDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVHGNNGSGNNTGQGETVEQE D0DAAE050FA2D488 gdu6_arath Protein GLUTAMINE DUMPER 6 GDU6 T4A2.7 At3g30725 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRPTPKVEIWKSPVPYLFGGLFLLVLLIALALLSLVCTHQKPSSSSNNNHMDEEDDVGDKDAKPITREYLPKIVVILAGDNKPTCLAVPVVVPPPTSIFRCNCDNVTVIST 26C94317CC0A0ABA gdu4_arath Protein GLUTAMINE DUMPER 4 GDU4 F27A10.11 At2g24762 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRPLSIKPTSLDVARHATSVESFGNHRPPISPWHSPVPYLFGGLAAMLGLIAFALLILACSYWRLSTSGDDSGERVDEEKESRSGVKAASAACEEKVLVIMAGDDLPRFLATPAANKCMCGHEGRMVIFKEDGIGAGEEKMGDREKAKENEETTSQ 413DFCC110E4885F log2-gdu1-5 1 LOG2 10 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain GDU1 3 unspecified role unspecified role prey prey living cell living cell O81775:p.Gly100Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G R Wed May 02 15:39:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly100arg' Tue Jun 30 19:49:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly100Arg' tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2a log2-gdu1-6 1 GDu1 3 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O81775:p.Val96_Gly100delinsPhePhePhePhePhe mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain VIMAG FFFFF Thu Jul 07 12:07:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was val96phe; iso97phe; met98phe; ala99phe; gly100phe Fri Jul 22 11:07:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val96phe,ile97phe,met98phe,ala99phe,gly100phe' Wed May 02 16:48:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_ile_met_ala_gly96-100phe_phe_phe_phe_phe' Tue Jun 30 19:05:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val96_Gly100delinsPhePhePhePhePhe' LOG2 10 unspecified role unspecified role bait bait living cell living cell binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2a gdu1-log2-1 1 GDU1 3 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O81775:p.Val96_Gly100delinsPhePhePhePhePhe mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain VIMAG FFFFF Thu Jul 07 12:16:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was val96phe; iso97phe; met98phe; ala99phe; gly100phe Fri Jul 22 10:56:22 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val96phe,ile97phe,met98phe,ala99phe,gly100phe' Wed May 02 17:40:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_ile_met_ala_gly96-100phe_phe_phe_phe_phe' Tue Jun 30 15:57:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val96_Gly100delinsPhePhePhePhePhe' LOG2 10 unspecified role unspecified role prey prey living cell living cell binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2a gdu1-log2-2 1 GDU1 3 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O81775:p.Gly100Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G R Wed May 02 15:41:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly100arg' Tue Jun 30 18:34:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly100Arg' LOG2 10 unspecified role unspecified role prey prey living cell living cell binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2a log2-gdu1-7 2 GDU1 3 unspecified role unspecified role prey prey living cell living cell tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined LOG2 10 unspecified role unspecified role bait bait living cell living cell binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f2b gdu1-mgrn1-1 1 GDU1 3 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain hsMGRN1 4 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a mgrn1-gdu1 1 hsMGRN1 4 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GDU1 3 unspecified role unspecified role prey prey living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a gdu2-mgrn1 1 GDU2 5 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain hsMGRN1 4 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a mgrn1-gdu2 1 hsMGRN1 4 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GDU2 5 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f3a mgrn1-gdu3-1 1 hsMGRN1 4 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a gdu3-mgrn1 1 hsMGRN1 4 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f3a gdu4-mgrn1 1 GDU4 12 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain hsMGRN1 4 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a mgrn1-gdu4 1 hsMGRN1 4 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GDU4 12 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f3a mgrn1-gdu5 1 GDU5 6 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain hsMGRN1 4 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a gdu5-mgrn1 1 GDU5 6 unspecified role unspecified role bait bait living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined hsMGRN1 4 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a gdu6-mgrn1 1 hsMGRN1 4 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GDU6 11 unspecified role unspecified role bait bait tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f3a mgrn1-gdu6 1 hsMGRN1 4 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GDU6 11 unspecified role unspecified role prey prey tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f3a mgrn1-gdu7 1 GDU7 9 unspecified role unspecified role prey prey living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined hsMGRN1 4 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a gdu7-mgrn1 1 hsMGRN1 4 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GDU7 9 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f3a gdu1-mgrn1-2 1 GDU1 3 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain rnMGRN1 7 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a mgrn1-gdu1-1 1 rnMGRN1 7 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GDU1 3 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f3a gdu2-mgrn1-1 1 GDU2 5 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain rnMGRN1 7 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a mgrn1-gdu2-1 1 rnMGRN1 7 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GDU2 5 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f3a mgrn1-gdu3-2 1 rnMGRN1 7 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a gdu3-mgrn1-1 1 rnMGRN1 7 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a gdu4-mgrn1-1 1 GDU4 12 unspecified role unspecified role bait bait living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rnMGRN1 7 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a mgrn1-gdu4-1 1 rnMGRN1 7 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GDU4 12 unspecified role unspecified role prey prey living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a mgrn1-gdu5-1 1 GDU5 6 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain rnMGRN1 7 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a gdu5-mgrn1-1 1 GDU5 6 unspecified role unspecified role bait bait living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rnMGRN1 7 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a gdu6-mgrn1-1 1 rnMGRN1 7 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GDU6 11 unspecified role unspecified role bait bait binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a mgrn1-gdu6-1 1 GDU6 11 unspecified role unspecified role prey prey binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rnMGRN1 7 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a mgrn1-gdu7-1 1 GDU7 9 unspecified role unspecified role prey prey living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rnMGRN1 7 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a gdu7-mgrn1-1 1 GDU7 9 unspecified role unspecified role bait bait living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain rnMGRN1 7 unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a gdu1-mgrn1-3 2 GDU1 3 unspecified role unspecified role prey prey purified purified O81775:p.Gly100Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G R Wed May 02 18:06:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly100arg' Tue Jun 30 17:14:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly100Arg' tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain rnMGRN1 7 unspecified role unspecified role bait bait purified purified tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f3b log2-gdu1-8 2 10 unspecified role unspecified role bait bait purified purified tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GDU1 3 unspecified role unspecified role prey prey purified purified tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O81775:p.Gly100Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G R Wed May 02 16:02:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly100arg' Tue Jun 30 19:28:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly100Arg' binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f3b