IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A conserved N-terminal motif is required for complex formation between FUS, EWSR1, TAF15 and their oncogenic fusion proteins. A conserved N-terminal motif is required for complex formation between FUS, EWSR1, TAF15 and their oncogenic fusion proteins. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2013 imex curation Thomsen C., Grundevik P., Elias P., Ståhlberg A., Aman P. 19-08-2013: Aman, P. Sahlgrenska Cancer Center, Institute of Biomedicine, University of Gothenburg. Files for this submission can be found in \pro6\intact\local\data\curation-material\2013 Experiment from figure 2d was not included due the impossibility to ascertain the preys identity with the participant detection method used (coomasie staining on a cell lysate). Sequence of FUS-DDIT3 chimera given by the authors. It is the shortest one (type II) of the most common two variants of this chimera. Information about the constructs was given by the authors. pierre.aman@llcr.med.gu.se 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot 19-08-2013: Aman, P. Sahlgrenska Cancer Center, Institute of Biomedicine, University of Gothenburg. Files for this submission can be found in \pro6\intact\local\data\curation-material\2013 Experiment from figure 2d was not included due the impossibility to ascertain the preys identity with the participant detection method used (coomasie staining on a cell lysate). Sequence of FUS-DDIT3 chimera given by the authors. It is the shortest one (type II) of the most common two variants of this chimera. Information about the constructs was given by the authors. pierre.aman@llcr.med.gu.se Accepted 2013-AUG-28 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation A conserved N-terminal motif is required for complex formation between FUS, EWSR1, TAF15 and their oncogenic fusion proteins. A conserved N-terminal motif is required for complex formation between FUS, EWSR1, TAF15 and their oncogenic fusion proteins. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2013 imex curation Thomsen C., Grundevik P., Elias P., Ståhlberg A., Aman P. 19-08-2013: Aman, P. Sahlgrenska Cancer Center, Institute of Biomedicine, University of Gothenburg. Files for this submission can be found in \pro6\intact\local\data\curation-material\2013 Experiment from figure 2d was not included due the impossibility to ascertain the preys identity with the participant detection method used (coomasie staining on a cell lysate). Sequence of FUS-DDIT3 chimera given by the authors. It is the shortest one (type II) of the most common two variants of this chimera. Information about the constructs was given by the authors. pierre.aman@llcr.med.gu.se 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down sequence tag sequence tag identification sequence tag 19-08-2013: Aman, P. Sahlgrenska Cancer Center, Institute of Biomedicine, University of Gothenburg. Files for this submission can be found in \pro6\intact\local\data\curation-material\2013 Experiment from figure 2d was not included due the impossibility to ascertain the preys identity with the participant detection method used (coomasie staining on a cell lysate). Sequence of FUS-DDIT3 chimera given by the authors. It is the shortest one (type II) of the most common two variants of this chimera. Information about the constructs was given by the authors. pierre.aman@llcr.med.gu.se Accepted 2013-AUG-28 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation A conserved N-terminal motif is required for complex formation between FUS, EWSR1, TAF15 and their oncogenic fusion proteins. A conserved N-terminal motif is required for complex formation between FUS, EWSR1, TAF15 and their oncogenic fusion proteins. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2013 imex curation Thomsen C., Grundevik P., Elias P., Ståhlberg A., Aman P. 19-08-2013: Aman, P. Sahlgrenska Cancer Center, Institute of Biomedicine, University of Gothenburg. Files for this submission can be found in \pro6\intact\local\data\curation-material\2013 Experiment from figure 2d was not included due the impossibility to ascertain the preys identity with the participant detection method used (coomasie staining on a cell lysate). Sequence of FUS-DDIT3 chimera given by the authors. It is the shortest one (type II) of the most common two variants of this chimera. Information about the constructs was given by the authors. pierre.aman@llcr.med.gu.se 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions human-mls_402_91 Homo sapiens mls_402_91 Myxoid liposarcoma cell line 402-91 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot 19-08-2013: Aman, P. Sahlgrenska Cancer Center, Institute of Biomedicine, University of Gothenburg. Files for this submission can be found in \pro6\intact\local\data\curation-material\2013 Experiment from figure 2d was not included due the impossibility to ascertain the preys identity with the participant detection method used (coomasie staining on a cell lysate). Sequence of FUS-DDIT3 chimera given by the authors. It is the shortest one (type II) of the most common two variants of this chimera. Information about the constructs was given by the authors. pierre.aman@llcr.med.gu.se Accepted 2013-AUG-28 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation A conserved N-terminal motif is required for complex formation between FUS, EWSR1, TAF15 and their oncogenic fusion proteins. A conserved N-terminal motif is required for complex formation between FUS, EWSR1, TAF15 and their oncogenic fusion proteins. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2013 imex curation Thomsen C., Grundevik P., Elias P., Ståhlberg A., Aman P. 19-08-2013: Aman, P. Sahlgrenska Cancer Center, Institute of Biomedicine, University of Gothenburg. Files for this submission can be found in \pro6\intact\local\data\curation-material\2013 Experiment from figure 2d was not included due the impossibility to ascertain the preys identity with the participant detection method used (coomasie staining on a cell lysate). Sequence of FUS-DDIT3 chimera given by the authors. It is the shortest one (type II) of the most common two variants of this chimera. Information about the constructs was given by the authors. pierre.aman@llcr.med.gu.se 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions human-ht1080 Homo sapiens HT1080 fribrosarcoma cell line ht1080 confirmed as human with IEF of AST, LDH, NP established from the biopsy from a fibrosarcoma of a 35-year-old Caucasian man in 1972 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence 19-08-2013: Aman, P. Sahlgrenska Cancer Center, Institute of Biomedicine, University of Gothenburg. Files for this submission can be found in \pro6\intact\local\data\curation-material\2013 Experiment from figure 2d was not included due the impossibility to ascertain the preys identity with the participant detection method used (coomasie staining on a cell lysate). Sequence of FUS-DDIT3 chimera given by the authors. It is the shortest one (type II) of the most common two variants of this chimera. Information about the constructs was given by the authors. pierre.aman@llcr.med.gu.se Accepted 2013-AUG-28 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation A conserved N-terminal motif is required for complex formation between FUS, EWSR1, TAF15 and their oncogenic fusion proteins. A conserved N-terminal motif is required for complex formation between FUS, EWSR1, TAF15 and their oncogenic fusion proteins. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2013 imex curation Thomsen C., Grundevik P., Elias P., Ståhlberg A., Aman P. 19-08-2013: Aman, P. Sahlgrenska Cancer Center, Institute of Biomedicine, University of Gothenburg. Files for this submission can be found in \pro6\intact\local\data\curation-material\2013 Experiment from figure 2d was not included due the impossibility to ascertain the preys identity with the participant detection method used (coomasie staining on a cell lysate). Sequence of FUS-DDIT3 chimera given by the authors. It is the shortest one (type II) of the most common two variants of this chimera. Information about the constructs was given by the authors. pierre.aman@llcr.med.gu.se 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions human-mls_2645_94 Homo sapiens mls_2645_94 Myxoid liposarcoma cell line 2645-94 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot 19-08-2013: Aman, P. Sahlgrenska Cancer Center, Institute of Biomedicine, University of Gothenburg. Files for this submission can be found in \pro6\intact\local\data\curation-material\2013 Experiment from figure 2d was not included due the impossibility to ascertain the preys identity with the participant detection method used (coomasie staining on a cell lysate). Sequence of FUS-DDIT3 chimera given by the authors. It is the shortest one (type II) of the most common two variants of this chimera. Information about the constructs was given by the authors. pierre.aman@llcr.med.gu.se Accepted 2013-AUG-28 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation A conserved N-terminal motif is required for complex formation between FUS, EWSR1, TAF15 and their oncogenic fusion proteins. A conserved N-terminal motif is required for complex formation between FUS, EWSR1, TAF15 and their oncogenic fusion proteins. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2013 imex curation Thomsen C., Grundevik P., Elias P., Ståhlberg A., Aman P. 19-08-2013: Aman, P. Sahlgrenska Cancer Center, Institute of Biomedicine, University of Gothenburg. Files for this submission can be found in \pro6\intact\local\data\curation-material\2013 Experiment from figure 2d was not included due the impossibility to ascertain the preys identity with the participant detection method used (coomasie staining on a cell lysate). Sequence of FUS-DDIT3 chimera given by the authors. It is the shortest one (type II) of the most common two variants of this chimera. Information about the constructs was given by the authors. pierre.aman@llcr.med.gu.se 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western 19-08-2013: Aman, P. Sahlgrenska Cancer Center, Institute of Biomedicine, University of Gothenburg. Files for this submission can be found in \pro6\intact\local\data\curation-material\2013 Experiment from figure 2d was not included due the impossibility to ascertain the preys identity with the participant detection method used (coomasie staining on a cell lysate). Sequence of FUS-DDIT3 chimera given by the authors. It is the shortest one (type II) of the most common two variants of this chimera. Information about the constructs was given by the authors. pierre.aman@llcr.med.gu.se Accepted 2013-AUG-28 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation A conserved N-terminal motif is required for complex formation between FUS, EWSR1, TAF15 and their oncogenic fusion proteins. A conserved N-terminal motif is required for complex formation between FUS, EWSR1, TAF15 and their oncogenic fusion proteins. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2013 imex curation Thomsen C., Grundevik P., Elias P., Ståhlberg A., Aman P. 19-08-2013: Aman, P. Sahlgrenska Cancer Center, Institute of Biomedicine, University of Gothenburg. Files for this submission can be found in \pro6\intact\local\data\curation-material\2013 Experiment from figure 2d was not included due the impossibility to ascertain the preys identity with the participant detection method used (coomasie staining on a cell lysate). Sequence of FUS-DDIT3 chimera given by the authors. It is the shortest one (type II) of the most common two variants of this chimera. Information about the constructs was given by the authors. pierre.aman@llcr.med.gu.se 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions human-ht1080 Homo sapiens HT1080 fribrosarcoma cell line ht1080 confirmed as human with IEF of AST, LDH, NP established from the biopsy from a fibrosarcoma of a 35-year-old Caucasian man in 1972 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot 19-08-2013: Aman, P. Sahlgrenska Cancer Center, Institute of Biomedicine, University of Gothenburg. Files for this submission can be found in \pro6\intact\local\data\curation-material\2013 Experiment from figure 2d was not included due the impossibility to ascertain the preys identity with the participant detection method used (coomasie staining on a cell lysate). Sequence of FUS-DDIT3 chimera given by the authors. It is the shortest one (type II) of the most common two variants of this chimera. Information about the constructs was given by the authors. pierre.aman@llcr.med.gu.se Accepted 2013-AUG-28 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation fus_ddit3 FUS-DDIT3 chimeric protein, type II. protein protein human Homo sapiens Human MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGVFKKEVYMAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA rbp56_human TATA-binding protein-associated factor 2N TAF15 RBP56 TAF2N RNA-binding protein 56 68 kDa TATA-binding protein-associated factor protein protein human Homo sapiens Human MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGGDRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYGGDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY DIP protein Q92804 original sequence version: 146 73D37C171E1E2BCA ews_human RNA-binding protein EWS EWSR1 EWS EWS oncogene Ewing sarcoma breakpoint region 1 protein protein protein human Homo sapiens Human MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY DIP protein Q01844 original sequence version: 164 0DA02CEE146720BB fus_human RNA-binding protein FUS FUS TLS Oncogene FUS Oncogene TLS Translocated in liposarcoma protein POMp75 75 kDa DNA-pairing protein protein protein human Homo sapiens Human MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY DIP protein P35637 original sequence version: 165 DIP protein P35637 original sequence version: 156 DIP protein P35637-1 original sequence version: 156 DIP protein P35637-1 original sequence version: 92 DIP protein P35637-1 original sequence version: 146 88C8E263B7905549 taf15-ewsr1-1 2 10 unspecified role unspecified role prey prey cell lysate cell lysate human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells 9 unspecified role unspecified role bait bait purified purified c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal domain (ntd) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey cell lysate cell lysate human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells 9 unspecified role unspecified role prey prey cell lysate cell lysate region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells association association 2b, supplementary table 1 fus-ewsr1 2 9 unspecified role unspecified role prey prey cell lysate cell lysate human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells 11 unspecified role unspecified role bait bait purified purified c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal domain (ntd) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey cell lysate cell lysate region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells 10 unspecified role unspecified role prey prey cell lysate cell lysate human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells association association 2b, supplementary table 1 ewsr1-fus 2 10 unspecified role unspecified role bait bait purified purified c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal domain (ntd) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey cell lysate cell lysate human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells 9 unspecified role unspecified role prey prey cell lysate cell lysate human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells 10 unspecified role unspecified role prey prey cell lysate cell lysate human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells association association 2b, supplementary table 1 taf15-ewsr1-2 1 11 unspecified role unspecified role prey prey cell lysate cell lysate human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells 9 unspecified role unspecified role bait bait purified purified n-terminal domain (ntd) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey cell lysate cell lysate human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells 9 unspecified role unspecified role prey prey cell lysate cell lysate human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells association association 2c ewsr1-fus-1 1 9 unspecified role unspecified role prey prey cell lysate cell lysate human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells 10 unspecified role unspecified role bait bait purified purified c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal domain (ntd) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey cell lysate cell lysate human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells 11 unspecified role unspecified role prey prey cell lysate cell lysate human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells association association 2c fus-ewsr1-1 1 9 unspecified role unspecified role prey prey cell lysate cell lysate human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells 10 unspecified role unspecified role prey prey cell lysate cell lysate human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells 11 unspecified role unspecified role prey prey cell lysate cell lysate human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells 11 unspecified role unspecified role bait bait purified purified c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal domain (ntd) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association 2c, 2e, 3b fus-ewsr1-2 6 11 unspecified role unspecified role bait bait purified purified c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal domain (ntd) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey cell lysate cell lysate c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human-ht1080 Homo sapiens HT1080 fribrosarcoma cell line ht1080 confirmed as human with IEF of AST, LDH, NP established from the biopsy from a fibrosarcoma of a 35-year-old Caucasian man in 1972 physical association physical association 4a, 4c fus_ddit3-ewsr1 7 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association 5a fus_ddit3-ewsr1-1 5 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association 5b fus_ddit3-ewsr1-2 3 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey association association 5b fus-fus_ddit3 4 11 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role neutral component neutral component c-terminal dsred1 fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 5c taf15-fus_ddit3 4 8 unspecified role unspecified role neutral component neutral component c-terminal dsred1 fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 5c fus_ddit3-ews 4 8 unspecified role unspecified role neutral component neutral component c-terminal dsred1 fluorescent prot tag fluorescent protein tag fluorescent prot tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 5c