MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The V1/V2 loop of HIV-1 gp120 is necessary for Tat binding and consequent modulation of virus entry The V1/V2 loop of HIV-1 gp120 is necessary for Tat binding and consequent modulation of virus entry FEBS Lett. (0014-5793) 2013 imex curation Cardaci S., Soster M., Bussolino F., Marchiò S. serena.marchio@ircc.it Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Cardaci S., Soster M., Bussolino F., Marchiò S. serena.marchio@ircc.it Accepted 2013-JUL-23 by LPERFETTO FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation env_hv1h2 Envelope glycoprotein gp160 env Env polyprotein protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 MRVKEKYQHLWRWGWRWGTMLLGMLMICSATEKLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWNHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFAVLSIVNRVRQGYSPLSFQTHLPTPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGACRAIRHIPRRIRQGLERILL DIP protein P04578 original sequence version: 85 DIP protein P04578 original sequence version: 140 6FAB16AF85107FE0 tat_hv1h2 Protein Tat tat Transactivating regulatory protein protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQPRGDPTGPKE 4DDC56D979769115 4DDC56D979769115 env-tat 1 Tat 3 unspecified role unspecified role bait bait purified purified tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) gp120 2 unspecified role unspecified role prey prey cell lysate cell lysate binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain P04578:p.[Lys168Ala;Gln170Ala;Lys171Ala] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain K A Fri Jul 22 11:10:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'gln170ala,lys171ala,lys168ala' Wed May 02 15:01:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys168ala,gln170ala,lys171ala' Tue Jun 30 17:37:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys168Ala;Gln170Ala;Lys171Ala]' polyprotein fragment polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association f3 This assay showed that Tat binding to both V1- and V2-gp120 was as low as ~30%, compared to wild-type gp120. Remarkably, V1/V2-gp120 was almost completely unable to interact with Tat (Figure 3B) tat-env 1 gp120 2 unspecified role unspecified role prey prey cell lysate cell lysate binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain polyprotein fragment polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain P04578:p.[Lys168Ala;Lys171Ala] mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain K A Wed May 02 15:26:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys168ala,lys171ala' Tue Jun 30 16:33:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys168Ala;Lys171Ala]' ecoli Escherichia coli (strain K12) Tat 3 unspecified role unspecified role bait bait purified purified tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association f3 This assay showed that Tat binding to both V1- and V2-gp120 was as low as ~30%, compared to wild-type gp120. Remarkably, V1/V2-gp120 was almost completely unable to interact with Tat (Figure 3B) tat-env-1 1 gp120 2 unspecified role unspecified role prey prey cell lysate cell lysate P04578:p.Lys168Ala mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 17:13:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys168ala' Tue Jun 30 15:47:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys168Ala' polyprotein fragment polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) Tat 3 unspecified role unspecified role bait bait purified purified tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association f3 This assay showed that Tat binding to both V1- and V2-gp120 was as low as ~30%, compared to wild-type gp120. Remarkably, V1/V2-gp120 was almost completely unable to interact with Tat (Figure 3B) tat-env-2 1 gp120 2 unspecified role unspecified role prey prey cell lysate cell lysate polyprotein fragment polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain P04578:p.[Gln170Ala;Lys171Ala] mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain Q A certain certain sequence position certain certain certain sequence position certain K A Wed May 02 16:23:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln170ala,lys171ala' Tue Jun 30 18:24:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln170Ala;Lys171Ala]' ecoli Escherichia coli (strain K12) Tat 3 unspecified role unspecified role bait bait purified purified tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association f3 This assay showed that Tat binding to both V1- and V2-gp120 was as low as ~30%, compared to wild-type gp120. Remarkably, V1/V2-gp120 was almost completely unable to interact with Tat (Figure 3B)