UniProt UniProt http://www.uniprot.org Ankyrin repeat domain protein 2 and inhibitor of DNA binding 3 cooperatively inhibit myoblast differentiation by physical interaction. Ankyrin repeat domain protein 2 and inhibitor of DNA binding 3 cooperatively inhibit myoblast differentiation by physical interaction. J. Biol. Chem. (0021-9258) 2013 imex curation Mohamed J.S., Lopez M.A., Cox G.A., Boriek A.M. boriek@bcm.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-myoblast Mus musculus myoblasts myoblast myoblast - a type of embryonic progenitor cell that differentiates to give rise to muscle cells anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Mohamed J.S., Lopez M.A., Cox G.A., Boriek A.M. boriek@bcm.edu Accepted 2013-NOV-26 by ORCHARD J. Biol. Chem. (0021-9258) 2013 Only protein-protein interactions imex curation Ankyrin repeat domain protein 2 and inhibitor of DNA binding 3 cooperatively inhibit myoblast differentiation by physical interaction. Ankyrin repeat domain protein 2 and inhibitor of DNA binding 3 cooperatively inhibit myoblast differentiation by physical interaction. J. Biol. Chem. (0021-9258) 2013 imex curation Mohamed J.S., Lopez M.A., Cox G.A., Boriek A.M. boriek@bcm.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-myoblast Mus musculus myoblasts myoblast myoblast - a type of embryonic progenitor cell that differentiates to give rise to muscle cells anti tag coip anti tag coimmunoprecipitation anti tag coip polyclonal western polyclonal antibody western blot polyclonal western Mohamed J.S., Lopez M.A., Cox G.A., Boriek A.M. boriek@bcm.edu Accepted 2013-NOV-26 by ORCHARD J. Biol. Chem. (0021-9258) 2013 Only protein-protein interactions imex curation Ankyrin repeat domain protein 2 and inhibitor of DNA binding 3 cooperatively inhibit myoblast differentiation by physical interaction. Ankyrin repeat domain protein 2 and inhibitor of DNA binding 3 cooperatively inhibit myoblast differentiation by physical interaction. J. Biol. Chem. (0021-9258) 2013 imex curation Mohamed J.S., Lopez M.A., Cox G.A., Boriek A.M. boriek@bcm.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-myoblast Mus musculus myoblasts myoblast myoblast - a type of embryonic progenitor cell that differentiates to give rise to muscle cells anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Mohamed J.S., Lopez M.A., Cox G.A., Boriek A.M. boriek@bcm.edu Accepted 2013-NOV-26 by ORCHARD J. Biol. Chem. (0021-9258) 2013 Only protein-protein interactions imex curation ankr2_mouse Ankyrin repeat domain-containing protein 2 Ankrd2 Arpp Skeletal muscle ankyrin repeat protein protein protein mouse Mus musculus Mouse MEGPEAVQRATELIEQRLAQEEETEKLRRSAPGKLSMDMLVLEEEKRLGVQSPALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAAAQEPPPEPEEITGPVNEETFLKAAVEGKMKVIDKYLADGGSADTCDEFRRTALHRASLEGHMEILEKLLENGATVDFQDRLDCTAMHWACRGGHLEVVRLLQSRGADTNVRDKLLSTPLHVAVRTGHVEIVEHFLSLGLDINAKDREGDSALHDAVRLNRYKIIKLLLLHGADMMAKNLAGKTPTDLVQLWQADTRHALEHPEPESEQNGLERPGSGRETPQPIPAQ DB90D955EE9D175E id3_mouse DNA-binding protein inhibitor ID-3 Id3 Hlh462 Id-3 Idb3 Inhibitor of DNA binding 3 ID-like protein inhibitor HLH 462 Inhibitor of differentiation 3 protein protein mouse Mus musculus Mouse MKALSPVRGCYEAVCCLSERSLAIARGRGKSPSTEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISKDKRSFCH 49F3B841D2D2BF15 ankrd2-id3 2 4 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey physical association physical association Fig 5B ankrd2-id3-1 1 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Fig 5C id3-ankrd2 1 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Fig 5C ankrd2-id3-2 3 4 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait physical association physical association Fig 5B