MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Lymphotoxin α induces apoptosis, necroptosis and inflammatory signals with the same potency as TNF. Lymphotoxin α induces apoptosis, necroptosis and inflammatory signals with the same potency as TNF. FEBS J. (1742-464X) 2013 imex curation Etemadi N., Holien JK., Chau D., Dewson G., Murphy JM., Alexander WS., Parker MW., Silke J., Nachbur U. suggested by lperfetto Only protein-protein interactions in vitro In vitro bn-page blue native page bn-page weight by comassie molecular weight estimation by coomasie staining weight by comassie Etemadi N., Holien JK., Chau D., Dewson G., Murphy JM., Alexander WS., Parker MW., Silke J., Nachbur U. suggested by lperfetto FEBS J. (1742-464X) 2013 imex curation Lymphotoxin α induces apoptosis, necroptosis and inflammatory signals with the same potency as TNF. Lymphotoxin α induces apoptosis, necroptosis and inflammatory signals with the same potency as TNF. FEBS J. (1742-464X) 2013 imex curation Etemadi N., Holien JK., Chau D., Dewson G., Murphy JM., Alexander WS., Parker MW., Silke J., Nachbur U. suggested by lperfetto Only protein-protein interactions human-u937_pr9 Homo sapiens U937-PR9 lymphoma cells expressing zinc-inducible PML-RAR alpha u937_pr9 U937-PR9 hematopoietic precursor cells expressing zinc-inducible PML-RAR alpha U937-PR9 cells, which are hematopoietic precursor cells carrying the PML-RARa coding sequence under the control of a zinc-inducible promoter. tap tandem affinity purification TAP TAP tap experimental particp experimental participant identification experimental particp Etemadi N., Holien JK., Chau D., Dewson G., Murphy JM., Alexander WS., Parker MW., Silke J., Nachbur U. suggested by lperfetto FEBS J. (1742-464X) 2013 imex curation tnfa_human Tumor necrosis factor TNF TNFA TNFSF2 TNF-alpha Tumor necrosis factor ligand superfamily member 2 Cachectin protein protein human Homo sapiens Human MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL DIP protein P01375 original sequence version: 198 DIP protein P01375 original sequence version: 151 DIP protein P01375 original sequence version: 156 DIP protein P01375 original sequence version: 186 DIP protein P01375 original sequence version: 201 DIP protein P01375 original sequence version: 174 DIP protein P01375 original sequence version: 211 3DF90F96C9031FFE ripk1_human Receptor-interacting serine/threonine-protein kinase 1 RIPK1 RIP Cell death protein RIP RIP1 Receptor-interacting protein 1 protein protein human Homo sapiens Human MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEALLEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMCIKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEEDVKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN DIP protein Q13546 original sequence version: 158 DIP protein Q13546-1 original sequence version: 140 DIP protein Q13546 original sequence version: 146 DIP protein Q13546-1 original sequence version: 146 DIP protein Q13546 original sequence version: 134 DIP protein Q13546 original sequence version: 109 976E2428D525A9B2 birc2_human Baculoviral IAP repeat-containing protein 2 Inhibitor of apoptosis protein 2 TNFR2-TRAF-signaling complex protein 2 IAP homolog B RING finger protein 48 BIRC2 API1 MIHB RNF48 RING-type E3 ubiquitin transferase BIRC2 Cellular inhibitor of apoptosis 1 protein protein human Homo sapiens Human MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLSTSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTTGENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS C1778D328063586D tnfb_human Lymphotoxin-alpha TNF-beta Tumor necrosis factor ligand superfamily member 1 LTA TNFB TNFSF1 protein protein human Homo sapiens Human MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL DIP protein P01374 original sequence version: 166 1BBD5E7D496A3A82 lta-1 1 LT alpha 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 3.0 direct interaction direct interaction sf1c mint tnf-3 1 TNF 3 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 3.0 direct interaction direct interaction sf1c mint lta-birc2 2 cIAP1 5 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level LT alpha 6 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RIPK1 4 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f3d mint We then tested the composition of the TNFR1 signalling complexes following TNF or LTα stimulation by immuno-precipitation using 2x Flag-Fc-tagged ligands and tandem affinity purification (Fig. 3D). It has been shown that upon TNF stimulation, RIPK1 is recruited to the TNFR1 signalling complex [64], where it is ubiquitylated by cIAPs [57, 65-67]. Consistent with previous reports for TNF signalling we observed ubiquitylated RIPK1 within 5 minutes after TNF treatment and this occurred following LTα stimulation too. We also detected cIAP1 and phosphorylated IKK1/2 in both TNF and LTα induced complexes. tnf-birc2 2 TNF 3 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cIAP1 5 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level RIPK1 4 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f3d mint We then tested the composition of the TNFR1 signalling complexes following TNF or LTα stimulation by immuno-precipitation using 2x Flag-Fc-tagged ligands and tandem affinity purification (Fig. 3D). It has been shown that upon TNF stimulation, RIPK1 is recruited to the TNFR1 signalling complex [64], where it is ubiquitylated by cIAPs [57, 65-67]. Consistent with previous reports for TNF signalling we observed ubiquitylated RIPK1 within 5 minutes after TNF treatment and this occurred following LTα stimulation too. We also detected cIAP1 and phosphorylated IKK1/2 in both TNF and LTα induced complexes.