MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Human Drg1 is a potassium-dependent GTPase enhanced by Lerepo4. Human Drg1 is a potassium-dependent GTPase enhanced by Lerepo4. FEBS J. (1742-464X) 2013 Pérez-Arellano I., Spínola-Amilibia M., Bravo J. suggested by lperfetto in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Pérez-Arellano I., Spínola-Amilibia M., Bravo J. suggested by lperfetto FEBS J. (1742-464X) 2013 drg1_human Developmentally-regulated GTP-binding protein 1 Neural precursor cell expressed developmentally down-regulated protein 3 DRG1 NEDD3 Translation factor GTPase DRG1 protein protein human Homo sapiens Human MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK 4A177EA7C8E23005 drg1-1 1 Drg1 2 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction mint sf5 A minor proportion of higher molecular weights with apparent molecular masses close to Drg1 dimer or tetramer were also detected (Fig. S5) drg1-1 1 Drg1 2 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction mint sf5 A minor proportion of higher molecular weights with apparent molecular masses close to Drg1 dimer or tetramer were also detected (Fig. S5)