MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it N-α-acetyltransferase 10 protein is a negative regulator of 28S proteasome through interaction with PA28β. N-α-acetyltransferase 10 protein is a negative regulator of 28S proteasome through interaction with PA28β. FEBS Lett. (0014-5793) 2013 Min L., Xu H., Wang J., Qu L., Jiang B., Zeng Y., Meng L., Jin H., Shou C. suggested by lperfetto human-rko Homo sapiens colorectal carcinoma cell line rko Human colorectal carcinoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip experimental particp experimental participant identification experimental particp Min L., Xu H., Wang J., Qu L., Jiang B., Zeng Y., Meng L., Jin H., Shou C. suggested by lperfetto FEBS Lett. (0014-5793) 2013 psme1_human Proteasome activator complex subunit 1 Proteasome activator 28 subunit alpha Activator of multicatalytic protease subunit 1 11S regulator complex subunit alpha Interferon gamma up-regulated I-5111 protein PSME1 IFI5111 protein protein human Homo sapiens Human MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY 5E27727E5A0B0AAB psme2_human Proteasome activator complex subunit 2 Proteasome activator 28 subunit beta Activator of multicatalytic protease subunit 2 11S regulator complex subunit beta PSME2 protein protein human Homo sapiens Human MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSLRAPLDIPIPDPPPKDDEMETDKQEKKEVHKCGFLPGNEKVLSLLALVKPEVWTLKEKCILVITWIQHLIPKIEDGNDFGVAIQEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASKETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIVNPKGEEKPSMY 98A30D83B3F93A91 naa10_human N-alpha-acetyltransferase 10 ARD1 NAA10 TE2 NatA catalytic subunit Naa10 ARD1A N-terminal acetyltransferase complex ARD1 subunit homolog A protein protein human Homo sapiens Human MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 6393A907F5C2DDC4 naa10-psme1 1 PS28 beta 3 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Naa10p 4 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PS28 alpha 2 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association f2a mint naa10-psme1-1 1 PS28 beta 3 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Naa10p 4 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PS28 alpha 2 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f2d mint