IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Molecular Mechanism of SSR128129E, an Extracellularly Acting, Small-Molecule, Allosteric Inhibitor of FGF Receptor Signaling. Molecular Mechanism of SSR128129E, an Extracellularly Acting, Small-Molecule, Allosteric Inhibitor of FGF Receptor Signaling. Cancer Cell (1535-6108) 2013 imex curation Herbert C., Schieborr U., Saxena K., Juraszek J., De Smet F., Alcouffe C., Bianciotto M., Saladino G., Sibrac D., Kudlinzki D., Sreeramulu S., Brown A., Rigon P., Herault J.P., Lassalle G., Blundell T.L., Rousseau F., Gils A., Schymkowitz J., Tompa P., Herbert J.M., Carmeliet P., Gervasio F.L., Schwalbe H., Bono F. Cancer - Interactions investigated in the context of cancer I have not annotated Fig 4A - X ray crystallography as resolution is very high (6A and 4A) and NO R Factor-Free/Working is given, which implies the data is not good. (The (potential) PDB entry looks to be a "model" only). Also:- "Crystals of FGF1/FGFR2-D2D3 complexes with SSR could not be optimized to a suitable diffraction quality". AND " the exact binding position of SR could not be visualized". - so neither SSR or SR crystals any good... "metadynamics experiments" are computational - not experimental. FGF1, FGF2 and FGFR4 have been entered as human in origin as all PDB entries quoted in the main publication and in Supplementary "In Silico Molecular Modelling" refer to Human molecules. No reply was received from any of the corresponding authors regarding origins of the above molecules. Results from Figure S1B (Dimerisation of FGF2, in vitro) have not been included as the origin of FGF2 cannot be traced - the supplier, R+D systems sell FGF2 from several species. flgervasio@cnio.es, schwalbe@nmr.uni-frankfurt.de, francoise.bono@sanofi-aventis.com Results from Fig 4A - (X ray crystallography) have not been annotated as the resolution is very high (6A and 4A) and NO R Factor-Free/Working is given, which implies the data is not good. 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Herbert C., Schieborr U., Saxena K., Juraszek J., De Smet F., Alcouffe C., Bianciotto M., Saladino G., Sibrac D., Kudlinzki D., Sreeramulu S., Brown A., Rigon P., Herault J.P., Lassalle G., Blundell T.L., Rousseau F., Gils A., Schymkowitz J., Tompa P., Herbert J.M., Carmeliet P., Gervasio F.L., Schwalbe H., Bono F. Cancer - Interactions investigated in the context of cancer I have not annotated Fig 4A - X ray crystallography as resolution is very high (6A and 4A) and NO R Factor-Free/Working is given, which implies the data is not good. (The (potential) PDB entry looks to be a "model" only). Also:- "Crystals of FGF1/FGFR2-D2D3 complexes with SSR could not be optimized to a suitable diffraction quality". AND " the exact binding position of SR could not be visualized". - so neither SSR or SR crystals any good... "metadynamics experiments" are computational - not experimental. Fourier transform infrared (FTIR) spectroscopy. FGF1, FGF2 and FGFR4 have been entered as human in origin as all PDB entries quoted in the main publication and in Supplementary "In Silico Molecular Modelling" refer to Human molecules. No reply was received from any of the corresponding authors regarding origins of the above molecules. flgervasio@cnio.es, schwalbe@nmr.uni-frankfurt.de, francoise.bono@sanofi-aventis.com Results from Fig 4A - (X ray crystallography) have not been annotated as the resolution is very high (6A and 4A) and NO R Factor-Free/Working is given, which implies the data is not good. Accepted 2013-JUL-09 by PPORRAS 02-Aug-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Molecular Mechanism of SSR128129E, an Extracellularly Acting, Small-Molecule, Allosteric Inhibitor of FGF Receptor Signaling. Molecular Mechanism of SSR128129E, an Extracellularly Acting, Small-Molecule, Allosteric Inhibitor of FGF Receptor Signaling. Cancer Cell (1535-6108) 2013 imex curation Herbert C., Schieborr U., Saxena K., Juraszek J., De Smet F., Alcouffe C., Bianciotto M., Saladino G., Sibrac D., Kudlinzki D., Sreeramulu S., Brown A., Rigon P., Herault J.P., Lassalle G., Blundell T.L., Rousseau F., Gils A., Schymkowitz J., Tompa P., Herbert J.M., Carmeliet P., Gervasio F.L., Schwalbe H., Bono F. Cancer - Interactions investigated in the context of cancer I have not annotated Fig 4A - X ray crystallography as resolution is very high (6A and 4A) and NO R Factor-Free/Working is given, which implies the data is not good. (The (potential) PDB entry looks to be a "model" only). Also:- "Crystals of FGF1/FGFR2-D2D3 complexes with SSR could not be optimized to a suitable diffraction quality". AND " the exact binding position of SR could not be visualized". - so neither SSR or SR crystals any good... "metadynamics experiments" are computational - not experimental. FGF1, FGF2 and FGFR4 have been entered as human in origin as all PDB entries quoted in the main publication and in Supplementary "In Silico Molecular Modelling" refer to Human molecules. No reply was received from any of the corresponding authors regarding origins of the above molecules. Results from Figure S1B (Dimerisation of FGF2, in vitro) have not been included as the origin of FGF2 cannot be traced - the supplier, R+D systems sell FGF2 from several species. flgervasio@cnio.es, schwalbe@nmr.uni-frankfurt.de, francoise.bono@sanofi-aventis.com Results from Fig 4A - (X ray crystallography) have not been annotated as the resolution is very high (6A and 4A) and NO R Factor-Free/Working is given, which implies the data is not good. 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Herbert C., Schieborr U., Saxena K., Juraszek J., De Smet F., Alcouffe C., Bianciotto M., Saladino G., Sibrac D., Kudlinzki D., Sreeramulu S., Brown A., Rigon P., Herault J.P., Lassalle G., Blundell T.L., Rousseau F., Gils A., Schymkowitz J., Tompa P., Herbert J.M., Carmeliet P., Gervasio F.L., Schwalbe H., Bono F. Cancer - Interactions investigated in the context of cancer I have not annotated Fig 4A - X ray crystallography as resolution is very high (6A and 4A) and NO R Factor-Free/Working is given, which implies the data is not good. (The (potential) PDB entry looks to be a "model" only). Also:- "Crystals of FGF1/FGFR2-D2D3 complexes with SSR could not be optimized to a suitable diffraction quality". AND " the exact binding position of SR could not be visualized". - so neither SSR or SR crystals any good... "metadynamics experiments" are computational - not experimental. FGF1, FGF2 and FGFR4 have been entered as human in origin as all PDB entries quoted in the main publication and in Supplementary "In Silico Molecular Modelling" refer to Human molecules. No reply was received from any of the corresponding authors regarding origins of the above molecules. flgervasio@cnio.es, schwalbe@nmr.uni-frankfurt.de, francoise.bono@sanofi-aventis.com Results from Fig 4A - (X ray crystallography) have not been annotated as the resolution is very high (6A and 4A) and NO R Factor-Free/Working is given, which implies the data is not good. Accepted 2013-JUL-09 by PPORRAS 02-Aug-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation fgfr1_human Fibroblast growth factor receptor 1 FGFR1 FGFBR FLG FLT2 Fms-like tyrosine kinase 2 Proto-oncogene c-Fgr BFGFR CEK HBGFR Basic fibroblast growth factor receptor 1 N-sam protein protein human Homo sapiens Human MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR DIP protein P11362 original sequence version: 154 DIP protein P11362 original sequence version: 160 DIP protein P11362 original sequence version: 180 DIP protein P11362 original sequence version: 170 93A01B5D78C3E72C ssr SSR128129E small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) p05230-pro_0000008908 Fibroblast growth factor 1 FGF1 FGFA Acidic fibroblast growth factor Endothelial cell growth factor Heparin-binding growth factor 1 protein protein human Homo sapiens Human FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD 16 155 0B083F14550D8D74 fgfr4_human Fibroblast growth factor receptor 4 FGFR4 JTK2 TKF protein protein human Homo sapiens Human MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTPTIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLDVLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFPYVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTAAAPEARYTDIILYASGSLALAVLLLLAGLYRGQALHGRHPRPPATVQKLSRFPLARQFSLESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLPLGSSSFPFGSGVQT DIP protein P22455 original sequence version: 123 DIP protein P22455-1 original sequence version: 134 B22B259831BB889F fgfr2_human Fibroblast growth factor receptor 2 FGFR2 BEK KSAM Keratinocyte growth factor receptor KGFR K-sam protein protein human Homo sapiens Human MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT 6CD5001C960ED82F fgf2_human Fibroblast growth factor 2 Basic fibroblast growth factor FGF2 FGFB Heparin-binding growth factor 2 protein protein human Homo sapiens Human MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS DIP protein P09038 original sequence version: 169 DIP protein P09038 original sequence version: 129 EAE98552A39D5E19 fgfr4-ssr 2 6 unspecified role unspecified role neutral component neutral component d2_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1D and TABLE (S1) S2, RELATED TO FIGURE 1 STD-NMR showed that SSR bound all constructs containing D2 and/or D3. fgfr4-ssr-1 2 3 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range d3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1D-2 and TABLE (S1) S2, RELATED TO FIGURE 1 STD-NMR showed that SSR bound all constructs containing D2 and/or D3 fgfr4-ssr-2 2 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component d3_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain protein_g_tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 1D-3 and TABLE (S1) S2, RELATED TO FIGURE 1 STD-NMR showed that SSR bound all constructs containing D2 and/or D3. fgfr4-ssr-3 2 6 unspecified role unspecified role neutral component neutral component d3_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain protein_g_tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1Dand TABLE (S1) S2, RELATED TO FIGURE 1i STD-NMR showed that SSR bound all constructs containing D2 and/or D3. fgfr4-ssr-4 2 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role neutral component neutral component d3_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain thioredoxin_tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 1Dand TABLE (S1) S2, RELATED TO FIGURE 1ii STD-NMR showed that SSR bound all constructs containing D2 and/or D3. fgfr1-ssr 2 3 unspecified role unspecified role neutral component neutral component d3_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range thioredoxin_tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1D-2 and TABLE (S1) S2, RELATED TO FIGURE 1i STD-NMR showed that SSR bound all constructs containing D2 and/or D3 fgfr1-ssr-1 2 3 unspecified role unspecified role neutral component neutral component protein_g_tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range d3_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1D-2 and TABLE (S1) S2, RELATED TO FIGURE 1ii STD-NMR showed that SSR bound all constructs containing D2 and/or D3 fgfr1-ssr-2 2 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range d2_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 1D-2 and TABLE (S1) S2, RELATED TO FIGURE 1iv STD-NMR showed that SSR bound all constructs containing D2 and/or D3 fgfr2-ssr-1 2 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component d2_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 1D-3 and TABLE (S1) S2, RELATED TO FIGURE 1i STD-NMR showed that SSR bound all constructs containing D2 and/or D3. fgfr2-ssr-2 2 5 unspecified role unspecified role neutral component neutral component 14n_label isotope label isotope label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined d2_d3_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp fig 2G (H+I) STD-NMR showed that SSR bound all constructs containing D2 and/or D3. fgf1-fgfr2-4 2 7 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined d2_d3_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component direct interaction direct interaction 3D/E fgf1-fgfr2-6 2 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component d2_d3_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component direct interaction direct interaction table 1 Derivative 2 with a cyclo-propyl substituent at R2 and derivative 3 with a hydrogen rather than O-methyl group at R1 both bound to FGF1/FGFR2-D2D3- as found using (STD-NMR and waterLOGSY-NMR (H1). (for location of substituents see Fig 7A). I have not made chebi entries for these 2 derivatives - just added the modifications as a comment -as I have no idea of any name, chemical or otherwise - for them. (compound " 2 and 3"?) fgf1-fgfr2-7 2 8 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role neutral component neutral component d2_d3_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 3D/E Results suggest an additional binding site for SSR in D3 fgf2-fgfr1-3 2 3 unspecified role unspecified role neutral component neutral component d2_d3_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction 3D/Ei fgf1-fgfr2-8 2 5 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role neutral component neutral component d1_d2_d3_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 3F NMR titration experiments of the FGF1/FGFR1-D1D2D3 complex with SSR. Top: 1H 1D signal of the SSR methoxy resonance. Bottom: Chemical shift of the peak maximum (x axis) as a function of the ratio of complex to SSR concentration. No isotope is mentioned in the context of this figure - but "NMR signals only appear if the protein is labeled with 15N isotope" - so ? fgf1-fgfr2-9 1 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component P21802:p.Tyr328Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y D Wed May 02 18:29:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr328asp' Tue Jun 30 19:03:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr328Asp' d2_d3_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 4B fgf1-fgfr2-10 2 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined d2_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Table S2:RELATED TO FIGURE 3 InterPro is down so cannot check if there is not an InterPro XRef to add - I dont think there is, but.... fgfr1-ssr-3 2 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component d2_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Table S2:RELATED TO FIGURE 3i fgfr1-ssr-4 2 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role neutral component neutral component d2_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Table S2:RELATED TO FIGURE 3ii fgf1-fgfr4-1 2 5 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined d2_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Table S2:RELATED TO FIGURE 3iv fgf1-fgfr2-12 2 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range d2_d3_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component direct interaction direct interaction 3D/E