MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Two leucines in the N-terminal MAPK-docking site of tomato SlMKK2 are critical for interaction with a downstream MAPK to elicit programmed cell death associated with plant immunity. Two leucines in the N-terminal MAPK-docking site of tomato SlMKK2 are critical for interaction with a downstream MAPK to elicit programmed cell death associated with plant immunity. FEBS Lett. (0014-5793) 2013 Oh CS., Hwang J., Choi MS., Kang BC., Martin GB. co35@khu.ac.kr nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Oh CS., Hwang J., Choi MS., Kang BC., Martin GB. co35@khu.ac.kr FEBS Lett. (0014-5793) 2013 14337_sollc 14-3-3 protein 7 TFT7 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MEKEREKQVYLARLAEQAERYDEMVEAMKAIAKMDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEESKGHEQNVKRIKTYRQRVEDELTKICSDILSVIDEHLVPSSTTGESTVFYYKMKGDYYRYLAEFKAGDDRKEASEQSLKAYEAATATASSDLAPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLSEESYKDSTLIMQLLRDNLTLWTSDLEEGGEHSKGDERQGEN mint CAB34DFF9AFCD129 q66mh7_sollc 543947 LeMKK3 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MKTAKPLKQLKLSVPAQDTPISSFLTASGTFHDGDLLLNQKGLRLISEENESLPSETKEIDLQFSLEDLETIKVIGKGSGGVVQLVRHKWVGTLFALKVIQMNIQEDIRKQIVQELKINQASQCPHVVVCYHSFYHNGAISLVLEYMDRGSLVDVIGQLKTILEPYLAVVCKQVLQGLVYLHHERHVIHRDIKPSNLLVNHKGEVKITDFGVSAMLASSMGQRDTFVGTYNYMAPERISGSTYDYKSDIWSLGMVILECAIGRFPYIQSEDQQARPSFYELLDAIVSSPPPSAPVDQFSPEFCSFVSACIQKDPRDRSSALDLLSHPFVKKFEDKDIDLSILVSSLEPPVNFPR mint 247E8AD6CC65CEE2 q66mh8_sollc LeMKK2 MAPKK5 MKK5 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MRPAANSTNAASSMPPPSSAGQRSRPRRRTDLTLPLPQRDVALAVPLPLPPTSSSSSSSPLPTPLHFSELERVNRIGSGTGGTVYKVLHRPTGRLYALKVIYGNHEDSVRLQMCREIEILRDVDNPNVVRCHDMFDHNGEIQVLLEFMDKGSLEGIHIPLEQPLSDLTRQVLSGLYYLHRRKIVHRDIKPSNLLINSRREVKIADFGVSRVLAQTMDPCNSSVGTIAYMSPERINTDLNHGQYDGYAGDIWSLGVSILEFYLGRFPFSVGRQGDWASLMCAICMSQPPEAPPSASREFREFIACCLQRDPARRWTAGQLLRHPFITQNSTGTTHTGPATTTTSLSHPLLPPPPHFSSSS mint 0A667AA0FF12E19D lemkk3-lemkk2 1 SlMKK2 4 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q66MH8:p.Arg28Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:12:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:46:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg28ala' Tue Jun 30 20:03:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg28Ala' Q66MH8:p.Leu34Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:52:50 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 20:17:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu34ala' Tue Jun 30 17:50:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu34Ala' Q66MH8:p.Leu32Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:52:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 20:28:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu32ala' Tue Jun 30 17:17:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu32Ala' Q66MH8:p.Arg29Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:13:02 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:57:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg29ala' Tue Jun 30 17:15:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg29Ala' SlMPK3 3 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1b f1c mint tft7-tft7 1 TFT7 2 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TFT7 2 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2 domino mint lemkk3-lemkk2-1 1 SlMPK3 3 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SlMKK2 4 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q66MH8:p.Arg28Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:09:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:24:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg28ala' Tue Jun 30 17:39:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg28Ala' Q66MH8:p.Leu32Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:09:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:03:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu32ala' Tue Jun 30 19:31:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu32Ala' Q66MH8:p.Arg29Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:09:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:13:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg29ala' Tue Jun 30 17:36:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg29Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q66MH8:p.Leu34Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:09:39 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:46:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu34ala' Tue Jun 30 16:35:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu34Ala' gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3 mint lemkk3-lemkk2-2 1 SlMPK3 3 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SlMKK2 4 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q66MH8:p.Arg29Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:51:16 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:38:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg29ala' Tue Jun 30 17:39:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg29Ala' gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q66MH8:p.Arg28Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:51:31 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:51:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg28ala' Tue Jun 30 18:33:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg28Ala' physical association physical association f3 mint lemkk3-lemkk2-3 1 SlMKK2 4 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q66MH8:p.Leu34Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:09:46 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:31:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu34ala' Tue Jun 30 20:08:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu34Ala' Q66MH8:p.Leu32Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:09:44 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:06:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu32ala' Tue Jun 30 17:46:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu32Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SlMPK3 3 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3 mint