MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it MAP1B regulates microtubule dynamics by sequestering EB1/3 in the cytosol of developing neuronal cells. MAP1B regulates microtubule dynamics by sequestering EB1/3 in the cytosol of developing neuronal cells. EMBO J. (0261-4189) 2013 imex curation Tortosa E., Galjart N., Avila J., Sayas C.L., Tortosa E., Galjart N., Avila J., Sayas C.L. The origins of some constructs could not be determined;notably MAP1B‐N‐t (1–508) fragment/ MAP1B-GFP or myc tagged;mCherry-EB3. As the authors did not reply to a request for information interactions involving these constructs have not been annotated. Results from Supplementary Figure 5B have not been entered as the cell line/cells used have not been stated. javila@cbm.uam.es 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions mouse-nie-115 Mus musculus nie-115 nie-115 frap fluorescence recovery after photobleaching frap tag fluorescence tag visualisation by fluorescence tag fluorescence Tortosa E., Galjart N., Avila J., Sayas C.L., Tortosa E., Galjart N., Avila J., Sayas C.L. The origins of some constructs could not be determined;notably MAP1B‐N‐t (1–508) fragment/ MAP1B-GFP or myc tagged;mCherry-EB3. As the authors did not reply to a request for information interactions involving these constructs have not been annotated. Results from Supplementary Figure 5B have not been entered as the cell line/cells used have not been stated. javila@cbm.uam.es Accepted 2017-NOV-29 AT 11:52 GMT AT 11:52 GMT by MGT EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation MAP1B regulates microtubule dynamics by sequestering EB1/3 in the cytosol of developing neuronal cells. MAP1B regulates microtubule dynamics by sequestering EB1/3 in the cytosol of developing neuronal cells. EMBO J. (0261-4189) 2013 imex curation Tortosa E., Galjart N., Avila J., Sayas C.L., Tortosa E., Galjart N., Avila J., Sayas C.L. The origins of some constructs could not be determined;notably MAP1B‐N‐t (1–508) fragment/ MAP1B-GFP or myc tagged;mCherry-EB3. As the authors did not reply to a request for information interactions involving these constructs have not been annotated. Results from Supplementary Figure 5B have not been entered as the cell line/cells used have not been stated. javila@cbm.uam.es 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions mouse-nie-115 Mus musculus nie-115 nie-115 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Tortosa E., Galjart N., Avila J., Sayas C.L., Tortosa E., Galjart N., Avila J., Sayas C.L. The origins of some constructs could not be determined;notably MAP1B‐N‐t (1–508) fragment/ MAP1B-GFP or myc tagged;mCherry-EB3. As the authors did not reply to a request for information interactions involving these constructs have not been annotated. Results from Supplementary Figure 5B have not been entered as the cell line/cells used have not been stated. javila@cbm.uam.es Accepted 2017-NOV-29 AT 11:52 GMT AT 11:52 GMT by MGT EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation MAP1B regulates microtubule dynamics by sequestering EB1/3 in the cytosol of developing neuronal cells. MAP1B regulates microtubule dynamics by sequestering EB1/3 in the cytosol of developing neuronal cells. EMBO J. (0261-4189) 2013 imex curation Tortosa E., Galjart N., Avila J., Sayas C.L., Tortosa E., Galjart N., Avila J., Sayas C.L. The origins of some constructs could not be determined;notably MAP1B‐N‐t (1–508) fragment/ MAP1B-GFP or myc tagged;mCherry-EB3. As the authors did not reply to a request for information interactions involving these constructs have not been annotated. Results from Supplementary Figure 5B have not been entered as the cell line/cells used have not been stated. javila@cbm.uam.es 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tortosa E., Galjart N., Avila J., Sayas C.L., Tortosa E., Galjart N., Avila J., Sayas C.L. The origins of some constructs could not be determined;notably MAP1B‐N‐t (1–508) fragment/ MAP1B-GFP or myc tagged;mCherry-EB3. As the authors did not reply to a request for information interactions involving these constructs have not been annotated. Results from Supplementary Figure 5B have not been entered as the cell line/cells used have not been stated. javila@cbm.uam.es Accepted 2017-NOV-29 AT 11:52 GMT AT 11:52 GMT by MGT EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation MAP1B regulates microtubule dynamics by sequestering EB1/3 in the cytosol of developing neuronal cells. MAP1B regulates microtubule dynamics by sequestering EB1/3 in the cytosol of developing neuronal cells. EMBO J. (0261-4189) 2013 imex curation Tortosa E., Galjart N., Avila J., Sayas C.L., Tortosa E., Galjart N., Avila J., Sayas C.L. The origins of some constructs could not be determined;notably MAP1B‐N‐t (1–508) fragment/ MAP1B-GFP or myc tagged;mCherry-EB3. As the authors did not reply to a request for information interactions involving these constructs have not been annotated. Results from Supplementary Figure 5B have not been entered as the cell line/cells used have not been stated. javila@cbm.uam.es 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Tortosa E., Galjart N., Avila J., Sayas C.L., Tortosa E., Galjart N., Avila J., Sayas C.L. The origins of some constructs could not be determined;notably MAP1B‐N‐t (1–508) fragment/ MAP1B-GFP or myc tagged;mCherry-EB3. As the authors did not reply to a request for information interactions involving these constructs have not been annotated. Results from Supplementary Figure 5B have not been entered as the cell line/cells used have not been stated. javila@cbm.uam.es Accepted 2017-NOV-29 AT 11:52 GMT AT 11:52 GMT by MGT EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation MAP1B regulates microtubule dynamics by sequestering EB1/3 in the cytosol of developing neuronal cells. MAP1B regulates microtubule dynamics by sequestering EB1/3 in the cytosol of developing neuronal cells. EMBO J. (0261-4189) 2013 imex curation Tortosa E., Galjart N., Avila J., Sayas C.L., Tortosa E., Galjart N., Avila J., Sayas C.L. The origins of some constructs could not be determined;notably MAP1B‐N‐t (1–508) fragment/ MAP1B-GFP or myc tagged;mCherry-EB3. As the authors did not reply to a request for information interactions involving these constructs have not been annotated. Results from Supplementary Figure 5B have not been entered as the cell line/cells used have not been stated. javila@cbm.uam.es 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain_hippocampal_neuron Mus musculus, brain, hippocampal neurons brain-hippocampus_neuron Hippocampal neuron confocal microscopy confocal microscopy immunostaining immunostaining Tortosa E., Galjart N., Avila J., Sayas C.L., Tortosa E., Galjart N., Avila J., Sayas C.L. The origins of some constructs could not be determined;notably MAP1B‐N‐t (1–508) fragment/ MAP1B-GFP or myc tagged;mCherry-EB3. As the authors did not reply to a request for information interactions involving these constructs have not been annotated. Results from Supplementary Figure 5B have not been entered as the cell line/cells used have not been stated. javila@cbm.uam.es Accepted 2017-NOV-29 AT 11:52 GMT AT 11:52 GMT by MGT EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation MAP1B regulates microtubule dynamics by sequestering EB1/3 in the cytosol of developing neuronal cells. MAP1B regulates microtubule dynamics by sequestering EB1/3 in the cytosol of developing neuronal cells. EMBO J. (0261-4189) 2013 imex curation Tortosa E., Galjart N., Avila J., Sayas C.L., Tortosa E., Galjart N., Avila J., Sayas C.L. The origins of some constructs could not be determined;notably MAP1B‐N‐t (1–508) fragment/ MAP1B-GFP or myc tagged;mCherry-EB3. As the authors did not reply to a request for information interactions involving these constructs have not been annotated. Results from Supplementary Figure 5B have not been entered as the cell line/cells used have not been stated. javila@cbm.uam.es 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions mouse-n1e-115 Mus musculus neuroblastoma cells n1e-115 Mouse neuroblastoma confocal microscopy confocal microscopy immunostaining immunostaining Tortosa E., Galjart N., Avila J., Sayas C.L., Tortosa E., Galjart N., Avila J., Sayas C.L. The origins of some constructs could not be determined;notably MAP1B‐N‐t (1–508) fragment/ MAP1B-GFP or myc tagged;mCherry-EB3. As the authors did not reply to a request for information interactions involving these constructs have not been annotated. Results from Supplementary Figure 5B have not been entered as the cell line/cells used have not been stated. javila@cbm.uam.es Accepted 2017-NOV-29 AT 11:52 GMT AT 11:52 GMT by MGT EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation mare3_human Microtubule-associated protein RP/EB family member 3 End-binding protein 3 EB1 protein family member 3 RP3 MAPRE3 protein protein human Homo sapiens Human MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY DIP protein Q9UPY8 original sequence version: 128 DIP protein Q9UPY8-1 original sequence version: 109 0DA45E89A0B993D3 mare1_mouse Microtubule-associated protein RP/EB family member 1 Mapre1 APC-binding protein EB1 End-binding protein 1 protein protein mouse Mus musculus Mouse MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKEYDPVAARQGQETAVAPSLVAPALSKPKKPLGSSTAAPQRPIATQRTTAAPKAGPGMVRKNPGVGNGDDEAAELMQQVKVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY DIP protein Q61166 original sequence version: 101 8FE3AFB7A5AE7762 mare3_mouse Microtubule-associated protein RP/EB family member 3 Mapre3 EB1 protein family member 3 End-binding protein 3 RP3 protein protein mouse Mus musculus Mouse MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHEADAQILELNQQLLDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY 6713427C480838DC map1b_mouse Microtubule-associated protein 1B MAP1.2 MAP1(X) Map1b Mtap1b Mtap5 protein protein mouse Mus musculus Mouse MATVVVEATEPEPSGSIGNPAASTSPSLSHRFLDSKFYLLVVVGETVTEEHLRRAIGNIELGIRSWDTNLIECNLDQELKLFVSRHSARFSPEVPGQKILHHRSDVLETVVLINPSDEAVSTEVRLMITDAARHKLLVLTGQCFENTGELILQSGSFSFQNFIEIFTDQEIGELLSTTHPANKASLTLFCPEEGDWKNSNLDRHNLQDFINIKLNSASILPEMEGLSEFTEYLSESVEVPSPFDILEPPTSGGFLKLSKPCCYIFPGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRHLDRVDSILLTHIGDDNLPGINSMLQRKIAELEEERSQGSTSNSDWMKNLISPDLGVVFLNVPENLKDPEPNIKMKRSIEEACFTLQYLNKLSMKPEPLFRSVGNTIEPVILFQKMGVGKLEMYVLNPVKSSKEMQYFMQQWTGTNKDKAELILPNGQEVDIPISYLTSVSSLIVWHPANPAEKIIRVLFPGNSTQYNILEGLEKLKHLDFLKQPLATQKDLTGQVPTPPVKQVKLKQRADSRESLKPATKPVASKSVRKESKEETPEVTKTSQVEKTPKVESKEKVLVKKDKPVKTESKPSVTEKEVSSKEEQSPVKAEVAEKQATESKPKVTKDKVVKKEIKTKLEEKKEEKPKKEVVKKEDKTPLKKDEKPRKEEVKKEIKKEIKKEERKELKKEVKKETPLKDAKKEVKKEEKKEVKKEEKEPKKEIKKISKDIKKSTPLSDTKKPSALKPKVAKKEESTKKEPLAAGKLKDKGKVKVIKKEGKTTEAAATAVGTAATTAAVVAAAGIAASGPVKELEAERSLMSSPEDLTKDFEELKAEEIDVAKDIKPQLELIEDEEKLKETQPGEAYVIQKETEVSKGSAESPDEGITTTEGEGECEQTPEELEPVEKQGVDDIEKFEDEGAGFEESSETGDYEEKAETEEAEEPEEDGEDNASGSASKHSPTEDDESAKAEADVHLKEKRESVVSGDDRAEEDMDDVLEKGEAEQSEEEGEEEDKAEDAREEGYEPDKTEAEDYVMAVADKAAEAGVTEEQYGYLGTSAKQPGIQSPSREPASSIHDETLPGGSESEATASDEENREDQPEEFTATSGYTQSTIEISSEPTPMDEMSTPRDVMSDETNNEETESPSQEFVNITKYESSLYSQEYSKPAVASFNGLSEGSKTDATDGKDYNASASTISPPSSMEEDKFSKSALRDAYCSEEKELKASAELDIKDVSDERLSPAKSPSLSPSPPSPIEKTPLGERSVNFSLTPNEIKVSAEGEARSVSPGVTQAVVEEHCASPEEKTLEVVSPSQSVTGSAGHTPYYQSPTDEKSSHLPTEVTEKPQAVPVSFEFSEAKDENERASLSPMDEPVPDSESPVEKVLSPLRSPPLLGSESPYEDFLSADSKVLGRRSESPFEGKNGKQGFPDRESPVSDLTSTGLYQDKQEEKSTGFIPIKEDFGPEKKTSDVETMSSQSALALDERKLGGDVSPTQIDVSQFGSFKEDTKMSISEGTVSDKSATPVDEGVAEDTYSHMEGVASVSTASVATSSFPEPTTDDVSPSLHAEVGSPHSTEVDDSLSVSVVQTPTTFQETEMSPSKEECPRPMSISPPDFSPKTAKSRTPVQDHRSEQSSMSIEFGQESPEHSLAMDFSRQSPDHPTLGASVLHITENGPTEVDYSPSDIQDSSLSHKIPPTEEPSYTQDNDLSELISVSQVEASPSTSSAHTPSQIASPLQEDTLSDVVPPREMSLYASLASEKVQSLEGEKLSPKSDISPLTPRESSPLYSPGFSDSTSAAKETAAAHQASSSPPIDAATAEPYGFRSSMLFDTMQHHLALNRDLTTSSVEKDSGGKTPGDFNYAYQKPENAAGSPDEEDYDYESQEKTIRTHDVGGYYYEKTERTIKSPCDSGYSYETIEKTIKTPEDGGYTCEITEKTTRTPEEGGYSYEISEKTTRTPEVSGYTYEKTERSRRLLDDISNGYDDTEDGGHTLGDCSYSYETTEKITSFPESESYSYETSTKTTRSPDTSAYCYETMEKITKTPQASTYSYETSDRCYTTEKKSPSEARQDVDLCLVSSCEFKHPKTELSPSFINPNPLEWFAGEEPTEESEKPLTQSGGAPPPSGGKQQGRQCDETPPTSVSESAPSQTDSDVPPETEECPSITADANIDSEDESETIPTDKTVTYKHMDPPPAPMQDRSPSPRHPDVSMVDPDALAVDQNLGKALKKDLKEKTKTKKPGTKTKSSSPVKKGDGKSKPLAASPKPGALKESSDKVSRVASPKKKESVEKATKTTTTPEVKATRGEEKDKETKNAANASASKSAKTATAGPGTTKTAKSSTVPPGLPVYLDLCYIPNHSNSKNVDVEFFKRVRSSYYVVSGNDPAAEEPSRAVLDALLEGKAQWGSNMQVTLIPTHDSEVMREWYQETHEKQQDLNIMVLASSSTVVMQDESFPACKIEL 2835101531B0694A map1b-mapre1-1 6 MAP1B 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level EB1 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Fig 1A Fig 1C map1b-mapre3-1 6 MAP1B 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level EB3 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Fig 1B Fig 1D map1b-mapre3-2 3 EB3 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level MAP1B 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig 4B map1b-mapre3-3 5 MAP1B 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell EB3 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization Fig 7A Immunofluorescence images showed that MAP1B and EBs localized to axons and axonal growth cones in 1DIV wild‐type (wt) neurons (Figures 7A and B; Supplementary Figure S11A) map1b-mapre3-4 5 EB3 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell MAP1B 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization supplementary fig 11 Immunofluorescence images showed that MAP1B and EBs localized to axons and axonal growth cones in 1DIV wild‐type (wt) neurons (Figures 7A and B; Supplementary Figure S11A) map1b-mapre1-2 2 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 4A-1 weak interaction Nocodazole map1b-mapre1-3 2 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 4A-2 weak interaction Nocodazole map1b-mapre1-4 2 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 4A, Supp fig 5A Nocodazole Both GFP‐tagged versions of EBs did co‐IP with MAP1B, GFP‐EBs (C-terminally tagged) co‐IPed better with MAP1B than EBs‐GFP. both GFP‐tagged versions of EBs did co‐IP with MAP1B, GFP‐EBs co‐IPed better with MAP1B than EBs‐GFP. Roscovitine (Seliciclib, CHEMBL14762) a cyclin-dependent kinase (CDK) inhibitor Lithium ions- an inhibitor of GSK3 map1b-mapre3-5 2 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 4A-4 Nocodazole 4747yry-1 4 10 unspecified role unspecified role prey prey cell lysate cell lysate mouse-brain Mus musculus brain brain Brain [cerebrum] 8 unspecified role unspecified role bait bait partially purified partially purified n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 4C mapre1-map1b-1 4 10 unspecified role unspecified role prey prey cell lysate cell lysate mouse-brain Mus musculus brain brain Brain [cerebrum] 7 unspecified role unspecified role bait bait partially purified partially purified n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 4Ci 789py78y9-1 1 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 5, supp fig 8 EB3 mobility is increased in the absence of MAP1B. Nocodazole treatment does not inhibit but exacerbates the effect of MAP1B deficiency on EB3 mobility. map1b-mapre3-6 6 MAP1B 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level EB3 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Supplementary Fig 4C Nocodazole Nocodazole led to enhanced colocalization of EB3 and MAP1B at the cytoplasm close to the cell cortex of Nocodazole-treated cells.