IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The interplay between RPGR, PDEδ and Arl2/3 regulate the ciliary targeting of farnesylated cargo. The interplay between RPGR, PDEδ and Arl2/3 regulate the ciliary targeting of farnesylated cargo. EMBO Rep. (1469-221X) 2013 imex curation Wätzlich D., Vetter I., Gotthardt K., Miertzschke M., Chen Y.X., Wittinghofer A., Ismail S. alfred.wittinghofer@mpi-dortmund.mpg.de,shehab.ismail@mpi-dortmund.mpg.de 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wätzlich D., Vetter I., Gotthardt K., Miertzschke M., Chen Y.X., Wittinghofer A., Ismail S. alfred.wittinghofer@mpi-dortmund.mpg.de,shehab.ismail@mpi-dortmund.mpg.de Accepted 2013-JUL-01 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation The interplay between RPGR, PDEδ and Arl2/3 regulate the ciliary targeting of farnesylated cargo. The interplay between RPGR, PDEδ and Arl2/3 regulate the ciliary targeting of farnesylated cargo. EMBO Rep. (1469-221X) 2013 imex curation Wätzlich D., Vetter I., Gotthardt K., Miertzschke M., Chen Y.X., Wittinghofer A., Ismail S. alfred.wittinghofer@mpi-dortmund.mpg.de,shehab.ismail@mpi-dortmund.mpg.de 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Wätzlich D., Vetter I., Gotthardt K., Miertzschke M., Chen Y.X., Wittinghofer A., Ismail S. Data on the identity, synthesis and features of F-Rheb (fully C-terminally S-farnesylated, carboxymethylated Rheb) was taken from PMID:22002721 and PMID:20652921. alfred.wittinghofer@mpi-dortmund.mpg.de,shehab.ismail@mpi-dortmund.mpg.de Accepted 2013-JUL-01 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation The interplay between RPGR, PDEδ and Arl2/3 regulate the ciliary targeting of farnesylated cargo. The interplay between RPGR, PDEδ and Arl2/3 regulate the ciliary targeting of farnesylated cargo. EMBO Rep. (1469-221X) 2013 imex curation Wätzlich D., Vetter I., Gotthardt K., Miertzschke M., Chen Y.X., Wittinghofer A., Ismail S. alfred.wittinghofer@mpi-dortmund.mpg.de,shehab.ismail@mpi-dortmund.mpg.de 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Wätzlich D., Vetter I., Gotthardt K., Miertzschke M., Chen Y.X., Wittinghofer A., Ismail S. alfred.wittinghofer@mpi-dortmund.mpg.de,shehab.ismail@mpi-dortmund.mpg.de Accepted 2013-JUL-01 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation The interplay between RPGR, PDEδ and Arl2/3 regulate the ciliary targeting of farnesylated cargo. The interplay between RPGR, PDEδ and Arl2/3 regulate the ciliary targeting of farnesylated cargo. EMBO Rep. (1469-221X) 2013 imex curation Wätzlich D., Vetter I., Gotthardt K., Miertzschke M., Chen Y.X., Wittinghofer A., Ismail S. alfred.wittinghofer@mpi-dortmund.mpg.de,shehab.ismail@mpi-dortmund.mpg.de 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps tag fluorescence tag visualisation by fluorescence tag fluorescence Wätzlich D., Vetter I., Gotthardt K., Miertzschke M., Chen Y.X., Wittinghofer A., Ismail S. Data on the identity, synthesis and features of F-Rheb (fully C-terminally S-farnesylated, carboxymethylated Rheb) and the C-terminal Rheb peptide was taken from PMID:22002721 and PMID:20652921. alfred.wittinghofer@mpi-dortmund.mpg.de,shehab.ismail@mpi-dortmund.mpg.de Accepted 2013-JUL-01 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation arl2_mouse ADP-ribosylation factor-like protein 2 Arl2 protein protein mouse Mus musculus Mouse MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSCNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSRVFTAD DIP protein Q9D0J4 original sequence version: 62 DIP protein Q9D0J4 original sequence version: 126 8B3741700BFED3F8 arl3_mouse ADP-ribosylation factor-like protein 3 Arl3 protein protein mouse Mus musculus Mouse MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK DIP protein Q9WUL7 original sequence version: 52 DIP protein Q9WUL7 original sequence version: 69 DIP protein Q9WUL7 original sequence version: 139 16B85B2268ADB9DE rpgr_human X-linked retinitis pigmentosa GTPase regulator RPGR RP3 XLRP3 protein protein human Homo sapiens Human MREPEELMPDSGAVFTFGKSKFAENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCVPQQVTIGKPVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSEIPEKVIQVACGGEHTVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCHMVVFAAPHRGVAKEIEFDEINDTCLSVATFLPYSSLTSGNVLQRTLSARMRRRERERSPDSFSMRRTLPPIEGTLGLSACFLPNSVFPRCSERNLQESVLSEQDLMQPEEPDYLLDEMTKEAEIDNSSTVESLGETTDILNMTHIMSLNSNEKSLKLSPVQKQKKQQTIGELTQDTALTENDDSDEYEEMSEMKEGKACKQHVSQGIFMTQPATTIEAFSDEEVGNDTGQVGPQADTDGEGLQKEVYRHENNNGVDQLDAKEIEKESDGGHSQKESEAEEIDSEKETKLAEIAGMKDLREREKSTKKMSPFFGNLPDRGMNTESEENKDFVKKRESCKQDVIFDSERESVEKPDSYMEGASESQQGIADGFQQPEAIEFSSGEKEDDEVETDQNIRYGRKLIEQGNEKETKPIISKSMAKYDFKCDRLSEIPEEKEGAEDSKGNGIEEQEVEANEENVKVHGGRKEKTEILSDDLTDKAEDHEFSKTEELKLEDVDEEINAENVESKKKTVGDDESVPTGYHSKTEGAERTNDDSSAETIEKKEKANLEERAICEYNENPKGYMLDDADSSSLEILENSETTPSKDMKKTKKIFLFKRVPSINQKIVKNNNEPLPEIKSIGDQIILKSDNKDADQNHMSQNHQNIPPTNTERRSKSCTIL EAB16275A9A436C3 pde6d_human Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta Protein p17 PDE6D PDED protein protein human Homo sapiens Human MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRLFYV DIP protein O43924 original sequence version: 114 DIP protein O43924 original sequence version: 140 AB8D9309C33B4411 q15382-pro_0000082708 GTP-binding protein Rheb RHEB RHEB2 Ras homolog enriched in brain protein protein human Homo sapiens Human MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSSC 1 181 A0BDF928FDA5CDDD pde6d-rpgr-4 1 8 unspecified role unspecified role neutral component neutral component ecobd Escherichia coli (strain B / BL21-DE3) 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) direct interaction direct interaction Fig. 2c, Fig. 2d, Fig. 2f, Suppl. table 1 1.90A working 19.9%, free 22.1% pde6d-rpgr-5 2 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O43924:p.Arg48Glu mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R E Wed May 02 17:04:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg48glu' Tue Jun 30 18:24:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg48Glu' ecobd Escherichia coli (strain B / BL21-DE3) 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q92834:p.Glu216Arg mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E R Wed May 02 17:51:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu216arg' Tue Jun 30 17:31:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu216Arg' ecobd Escherichia coli (strain B / BL21-DE3) direct interaction direct interaction Fig. 2f, Fig. 3b, Suppl. Fig. 3b, Suppl. Fig. 4 pde6d-rheb 2 F-RheB 9 unspecified role unspecified role prey prey cys-181 sfarnomecys S-farnesyl-L-cysteine methyl ester SFarnOMeCys certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobd Escherichia coli (strain B / BL21-DE3) direct interaction direct interaction Fig 3b pde6d-rheb-1 2 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobd Escherichia coli (strain B / BL21-DE3) 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) F-RheB 9 unspecified role unspecified role prey prey cys181 sfarnomecys S-farnesyl-L-cysteine methyl ester SFarnOMeCys certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) physical association physical association Fig. 3b pde6d-rpgr-6 4 8 unspecified role unspecified role neutral component neutral component region cy5 label cy5 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobd Escherichia coli (strain B / BL21-DE3) 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) direct interaction direct interaction Fig. 3c, Suppl. Fig. 3a Temp = 20C; pH = 7.5 pde6d-rheb-2 4 8 unspecified role unspecified role neutral component neutral component region cy5 label cy5 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobd Escherichia coli (strain B / BL21-DE3) 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) F-RheB 9 unspecified role unspecified role neutral component neutral component cys181 sfarnomecys S-farnesyl-L-cysteine methyl ester SFarnOMeCys certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) physical association physical association Fig. 3c Temp = 20C; pH = 7.5 arl3-pde6d-1 3 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 8 unspecified role unspecified role neutral component neutral component ecobd Escherichia coli (strain B / BL21-DE3) 6 unspecified role unspecified role neutral component neutral component ecobd Escherichia coli (strain B / BL21-DE3) physical association physical association Fig. 3e pde6d-rpgr-7 3 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 8 unspecified role unspecified role neutral component neutral component ecobd Escherichia coli (strain B / BL21-DE3) direct interaction direct interaction Fig. 3f arl2-pde6d-4 3 8 unspecified role unspecified role neutral component neutral component ecobd Escherichia coli (strain B / BL21-DE3) 5 unspecified role unspecified role neutral component neutral component ecobd Escherichia coli (strain B / BL21-DE3) direct interaction direct interaction Fig. 3f arl2-pde6d-5 3 5 unspecified role unspecified role neutral component neutral component ecobd Escherichia coli (strain B / BL21-DE3) 8 unspecified role unspecified role neutral component neutral component O43924:p.[Phe94Ala;Ile98Ala] mutation mutation substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain I A Wed May 02 15:45:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe94ala,ile98ala' Tue Jun 30 17:13:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe94Ala;Ile98Ala]' ecobd Escherichia coli (strain B / BL21-DE3) 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) physical association physical association Fig. 3g The phe94ala-ile98ala Pde6d mutant forms a stable ternary complex with RPGR and Arl2, while for wild type Pde6d only the binary Pde6d-RPGR and Pde6d-Arl2 complexes were observed. arl3-pde6d-2 2 8 unspecified role unspecified role prey prey O43924:p.[Phe94Ala;Ile98Ala] mutation mutation substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain I A Wed May 02 18:53:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe94ala,ile98ala' Tue Jun 30 15:39:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe94Ala;Ile98Ala]' ecobd Escherichia coli (strain B / BL21-DE3) 6 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecobd Escherichia coli (strain B / BL21-DE3) 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) physical association physical association Suppl. Fig. 6c The authors claim that a ternary Pde6d-RPGR-Arl3 complex could not be identified in pull down experiments using His-tagged Arl3 as bait with RPGR and wild type Pde6d as prey. pde6d-rheb-3 4 9 unspecified role unspecified role neutral component neutral component cys174 fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain cys181 sfarnomecys S-farnesyl-L-cysteine methyl ester SFarnOMeCys certain certain sequence position certain certain certain sequence position certain Q15382-PRO_0000082708:p.Ala174Cys mutation mutation certain certain sequence position certain certain certain sequence position certain A C Wed May 02 17:15:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala174cys' Tue Jun 30 17:01:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala174Cys' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component ecobd Escherichia coli (strain B / BL21-DE3) direct interaction direct interaction Fig. 4b, Suppl. Fig. 5 Temp = 20C; pH = 7.5 The presence of RPGR had no effect on the association or dissociation rate constants of the Rheb-Pde6d interaction. pde6d-rheb-4 4 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 9 unspecified role unspecified role neutral component neutral component cys181 sfarnomecys S-farnesyl-L-cysteine methyl ester SFarnOMeCys certain certain sequence position certain certain certain sequence position certain cys174 fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain Q15382-PRO_0000082708:p.Ala174Cys mutation mutation certain certain sequence position certain certain certain sequence position certain A C Wed May 02 15:32:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala174cys' Tue Jun 30 19:42:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala174Cys' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component ecobd Escherichia coli (strain B / BL21-DE3) physical association physical association Fig 4b Temp = 20C; pH = 7.5 Addition of non-hydrolysable GTP analogue GppNHp-bound Arl3 resulted in dissociation of the complex. pde6d-arl2 2 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobd Escherichia coli (strain B / BL21-DE3) 5 competitor competitor competitor prey prey ecobd Escherichia coli (strain B / BL21-DE3) 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) physical association physical association Suppl. Fig. 6a Arl2 is bound to non-hydrolysable GTP analogue GppNHp. pde6d-arl3 2 6 competitor competitor competitor prey prey ecobd Escherichia coli (strain B / BL21-DE3) 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobd Escherichia coli (strain B / BL21-DE3) 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) physical association physical association Suppl. Fig. 6b Arl3 is bound to non-hydrolysable GTP analogue GppNHp. arl3-pde6d-3 3 6 unspecified role unspecified role neutral component neutral component ecobd Escherichia coli (strain B / BL21-DE3) 8 unspecified role unspecified role neutral component neutral component ecobd Escherichia coli (strain B / BL21-DE3) direct interaction direct interaction Fig. 3e