MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Protective role of the endoplasmic reticulum protein mitsugumin23 against ultraviolet C-induced cell death. Protective role of the endoplasmic reticulum protein mitsugumin23 against ultraviolet C-induced cell death. FEBS Lett. (0014-5793) 2013 Yamashita A., Taniwaki T., Kaikoi Y., Yamazaki T. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid experimental particp experimental participant identification experimental particp Yamashita A., Taniwaki T., Kaikoi Y., Yamazaki T. FEBS Lett. (0014-5793) 2013 Protective role of the endoplasmic reticulum protein mitsugumin23 against ultraviolet C-induced cell death. Protective role of the endoplasmic reticulum protein mitsugumin23 against ultraviolet C-induced cell death. FEBS Lett. (0014-5793) 2013 Yamashita A., Taniwaki T., Kaikoi Y., Yamazaki T. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yamashita A., Taniwaki T., Kaikoi Y., Yamazaki T. FEBS Lett. (0014-5793) 2013 tm109_mouse Transmembrane protein 109 Tmem109 Mitsugumin-23 protein protein mouse Mus musculus Mouse MAGAHSTPLWSRHLLKAVLMVLVALFLVHSASAQSHREFASPGQQKKETSADILTQIGRSLKEMLDTWLGPETMHVISETLLQVMWAISSAISVACFALSGIAAQLLSALGLDGEQLTQGLKLSPSQVQTLLLWGAAALVIYWLLSLLLGLVLALLGRILGGLKLVLFVAGFVALVRSVPDPSTRALMLLALLTLFALLSRLTGSRSSGSHLEAKVRGLERQIEELRGRQRRAAKMPRSMEEE 31376625A07BF587 cryab_human Alpha-crystallin B chain CRYAB CRYA2 Renal carcinoma antigen NY-REN-27 Alpha(B)-crystallin Rosenthal fiber component Heat shock protein beta-5 HSPB5 protein protein human Homo sapiens Human MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK DIP protein P02511 original sequence version: null AE08BED46B7849CB DIP protein P02511 original sequence version: 195 DIP protein P02511 original sequence version: 130 DIP protein P02511 original sequence version: 131 DIP protein P02511 original sequence version: 151 DIP protein P02511 original sequence version: 167 DIP protein P02511 original sequence version: 154 DIP protein P02511 original sequence version: 146 AE08BED46B7849CB tmem109-cryab 2 αBC 4 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MG23 3 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint sf1d tmem109-cryab-1 1 MG23 3 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain αBC 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association homomint mint NO F To identify proteins interacting with the C-terminal region of MG23, yeast two-hybrid screening was performed using the CP2 region as a bait. One of the isolated clones corresponded to the C-terminal half (amino acid residues 89-175) of the small heat shock protein BC