IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell (0092-8674) 2013 imex curation Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell (0092-8674) 2013 imex curation Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-aska_ss Synoival sarcoma cells Aska-SS aska-ss Synovial sarcoma Aska-SS bearing the SS18-SSX1 chromosomal translocation density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell (0092-8674) 2013 imex curation Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. Concentration Urea (M) Cell (0092-8674) 2013 Only protein-protein interactions imex curation Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell (0092-8674) 2013 imex curation Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell (0092-8674) 2013 imex curation Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip sequence tag sequence tag identification sequence tag Kadoch C., Crabtree G.R. Peptides were identified by searching acquired mass spectra using SEQUEST (University of Washington) against the Mouse IPI database version 3.34. Peptide identifications were validated statistically using PeptideProphet, and the protein inference was performed using ProteinProphet, available as a part of the TransProteomic Pipeline. The list of protein identifications in each analysis was filtered using a 0.95 probability threshold or as otherwise stated (estimated error rate of less than 1%). All proteins identified in the control runs and other known contaminants were subtracted from the final list. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. Ammonium sulfate fractionation was followed by coimmunoprecipitation. crabtree@stanford.edu Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell (0092-8674) 2013 imex curation Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell (0092-8674) 2013 imex curation Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-aska_ss Synoival sarcoma cells Aska-SS aska-ss Synovial sarcoma Aska-SS bearing the SS18-SSX1 chromosomal translocation ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell (0092-8674) 2013 imex curation Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions rat-b35 Rattus norvegicus b35 B35 neuroblastoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell (0092-8674) 2013 imex curation Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell (0092-8674) 2013 imex curation Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip sequence tag sequence tag identification sequence tag Kadoch C., Crabtree G.R. Peptides were identified by searching acquired mass spectra using SEQUEST (University of Washington) against the Mouse IPI database version 3.34. Peptide identifications were validated statistically using PeptideProphet, and the protein inference was performed using ProteinProphet, available as a part of the TransProteomic Pipeline. The list of protein identifications in each analysis was filtered using a 0.95 probability threshold or as otherwise stated (estimated error rate of less than 1%). All proteins identified in the control runs and other known contaminants were subtracted from the final list. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. Ammonium sulfate fractionation was followed by coimmunoprecipitation. crabtree@stanford.edu Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell (0092-8674) 2013 imex curation Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. Concentration Urea (M) Cell (0092-8674) 2013 Only protein-protein interactions imex curation Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell (0092-8674) 2013 imex curation Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. Concentration Urea (M) Cell (0092-8674) 2013 Only protein-protein interactions imex curation Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell (0092-8674) 2013 imex curation Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell (0092-8674) 2013 imex curation Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-aska_ss Synoival sarcoma cells Aska-SS aska-ss Synovial sarcoma Aska-SS bearing the SS18-SSX1 chromosomal translocation anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell (0092-8674) 2013 imex curation Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell (0092-8674) 2013 imex curation Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip sequence tag sequence tag identification sequence tag Kadoch C., Crabtree G.R. Peptides were identified by searching acquired mass spectra using SEQUEST (University of Washington) against the Mouse IPI database version 3.34. Peptide identifications were validated statistically using PeptideProphet, and the protein inference was performed using ProteinProphet, available as a part of the TransProteomic Pipeline. The list of protein identifications in each analysis was filtered using a 0.95 probability threshold or as otherwise stated (estimated error rate of less than 1%). All proteins identified in the control runs and other known contaminants were subtracted from the final list. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. Ammonium sulfate fractionation was followed by coimmunoprecipitation. crabtree@stanford.edu Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell (0092-8674) 2013 imex curation Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-yomoto_ss Synovial sarcoma cell Yomoto-SS yamoto-ss Synovial sarcoma Yomoto-SS containg the SS18-SSX1 chromosomal translocation anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell (0092-8674) 2013 imex curation Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-yomoto_ss Synovial sarcoma cell Yomoto-SS yamoto-ss Synovial sarcoma Yomoto-SS containg the SS18-SSX1 chromosomal translocation density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell (0092-8674) 2013 imex curation Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions rat-b35 Rattus norvegicus b35 B35 neuroblastoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kadoch C., Crabtree G.R. I've not added the immunodepletion studies - its on our list as a technique but they must have isolated complexes afterwards and I can't tell how. crabtree@stanford.edu Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation smrc1_human SWI/SNF complex subunit SMARCC1 SMARCC1 BAF155 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1 SWI/SNF complex 155 kDa subunit BRG1-associated factor 155 protein protein human Homo sapiens Human MAAAAGGGGPGTAVGATGSGIAAAAAGLAVYRRKDGGPATKFWESPETVSQLDSVRVWLGKHYKKYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGALCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYSSSQDDEEWLRPVMRKEKQVLVHWGFYPDSYDTWVHSNDVDAEIEDPPIPEKPWKVHVKWILDTDIFNEWMNEEDYEVDENRKPVSFRQRISTKNEEPVRSPERRDRKASANARKRKHSPSPPPPTPTESRKKSGKKGQASLYGKRRSQKEEDEQEDLTKDMEDPTPVPNIEEVVLPKNVNLKKDSENTPVKGGTVADLDEQDEETVTAGGKEDEDPAKGDQSRSVDLGEDNVTEQTNHIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPVDLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDPTYGLESSCIAGTGPDEPEKLEGAEEEKMEADPDGQQPEKAENKVENETDEGDKAQDGENEKNSEKEQDSEVSEDTKSEEKETEENKELTDTCKERESDTGKKKVEHEISEGNVATAAAAALASAATKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREKEALEQQRQQLLTERQNFHMEQLKYAELRARQQMEQQQHGQNPQQAHQHSGGPGLAPLGAAGHPGMMPHQQPPPYPLMHHQMPPPHPPQPGQIPGPGSMMPGQHMPGRMIPTVAANIHPSGSGPTPPGMPPMPGNILGPRVPLTAPNGMYPPPPQQQPPPPPPADGVPPPPAPGPPASAAP DIP protein Q92922 original sequence version: 99 EDA6FF5B0472AEA9 d4abc5_rat Ss18 protein protein rat Rattus norvegicus (Rat) Rat MSVAFAAPRQRGKGEITPAAIQKMLDENNHLIQCIMDYQNKGKASECSQYQQILHTNLVYLATIADSNQNMQSLLPAPPTQNVPMGPGGMSQSGPPPPPRSHSMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPSQLSMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMNMQPNQGPMMHQQPPSQQYSMPPGGAQHYQGQQAPMGLMGQVNQGSHMMGQRQMPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGYQQPSYPEQGYDRPYEESSPHYCEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQGYGPTQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQGQYGNYQQ BE2998CD92874AD8 smrc1_mouse SWI/SNF complex subunit SMARCC1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1 SWI/SNF complex 155 kDa subunit BRG1-associated factor 155 SWI3-related protein Smarcc1 Baf155 Srg3 protein protein mouse Mus musculus Mouse MAATAGGGPGAAAGAVGAGGAAAASGLAVYRRKDGGPASKFWESPDTVSQLDSVRVWLGKHYKKYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGTLCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYPSSQEDEEWLRPVMRRDKQVLVHWGFYPDSYDTWVHSNDVDAEIEDAPIPEKPWKVHVKWILDTDVFNEWMNEEDYEVDENRKPVSFRQRISTKNEEPVRSPERRDRKASANSRKRKPSPSPPPPTATESRKKSGKKGQASLYGKRRSQKEEDEQEDLTKDMEDPTPVPNIEEVVLPKNVNPKKDSENTPVKGGTVADLDEQDEEAVTTGGKEDEDPSKGDPSRSVDPGEDNVTEQTNHIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPIDLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDPTYGLESSCIAGTGPDEPEKLEGSEEEKMETDPDGQQPEKAENKVENESDEGDKIQDRENEKNTEKEQDSDVSEDVKPEEKENEENKELTDTCKERESDAGKKKVEHEISEGNVATAAAAALASAATKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREKEALEQQRQQLLTERQNFHMEQLKYAELRARQQMEQQQQHGQTPQQAHQHTGGPGMAPLGATGHPGMMPHQQPPPYPLMHHQMPPPHPPQPGQIPGPGSMMPGQPMPGRMIPAVAANIHPTGSGPTPPGMPPMPGNILGPRVPLTAPNGMYPPPPQQQQPPPPADGVPPPPAPGPPASATP DIP protein P97496 original sequence version: 93 DIP protein P97496 original sequence version: 103 DIP protein P97496 original sequence version: 95 DIP protein P97496 original sequence version: 117 9030545104B90CAF ssxt_mouse_gene Protein SSXT gene gene mouse Mus musculus Mouse ari1a_human AT-rich interactive domain-containing protein 1A hELD SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1 SWI/SNF complex protein p270 B120 SWI-like protein Osa homolog 1 BRG1-associated factor 250 BRG1-associated factor 250a ARID1A C1orf4 SMARCF1 OSA1 BAF250 BAF250A protein protein human Homo sapiens Human MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPGLAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQRFGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHAPMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAFSGKDKPASENSEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKTELLPSRPHAPCPPAPRKHVTTAEGTPGTTDQEGPPPDGPPEKRITATMDDMLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS 85BC5B6061625D8E smca4_human Transcription activator BRG1 SMARCA4 BRG1 SNF2B SNF2L4 ATP-dependent helicase SMARCA4 SNF2-beta BAF190A Mitotic growth and transcription activator Protein BRG-1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4 Protein brahma homolog 1 BRG1-associated factor 190A protein protein human Homo sapiens Human MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGADPQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPMVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGSGSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED DIP protein P51532 original sequence version: 125 DIP protein P51532 original sequence version: 115 DIP protein P51532 original sequence version: 154 DIP protein P51532 original sequence version: 136 DIP protein P51532-1 original sequence version: 136 ABDA5EDBF10D7D28 requ_human Zinc finger protein ubi-d4 DPF2 REQ UBID4 Protein requiem Apoptosis response zinc finger protein D4, zinc and double PHD fingers family 2 BAF45D BRG1-associated factor 45D protein protein human Homo sapiens Human MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGSARKKLDASILEDRDKPYACDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS 1044B4D3036075FC ssxt-ssx4_human SSXT-SSX2 fusion protein SS18/SSX1 fusion protein protein human Homo sapiens Human MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGYQQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE 5C71C4366F388A7F ari1a_mouse AT-rich interactive domain-containing protein 1A Arid1a Baf250 Baf250a Osa1 Smarcf1 SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1 SWI/SNF complex protein p270 SWI-like protein Osa homolog 1 BRG1-associated factor 250 BRG1-associated factor 250a protein protein mouse Mus musculus Mouse MAAQVAPAAASSLGNPPPPPSELKKAEQQQREEAGGEAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLPEPPGGGGGGGSSSSDGVGAPPHSAAAALPPPAYGFGQAYGRSPSAVAAAAAAVFHQQHGGQQSPGLAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPPQAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQRFGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYGGGPQDGGAGKGPADMASQCWGAAAAAAAAAAAVSGGAQQRSHHAPMSPGSSGGGGQPLARTPQSSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGSLSYAQQIPPYGQQGPSAYGQQGQTPYYNQQSPHPQQQPPYAQQPPSQTPHAQPSYQQQPQTQQPQLQSSQPPYSQQPSQPPHQQSPTPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQQPQQPASSSLSQQAAYPQPQPQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYTSPQPGSALSPRQPSGGQMHSGVGSYQQNSMGSYGPQGSQYGPQGGYPRQPNYNALPNANYPNAGMAGSMNPMGAGGQMHGQPGIPPYGTLPPGRMAHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQESAVAMHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYPMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFPDGSDPTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGSVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMGTGAPQPNLMPSTPDSGMYSPSRYPPQQQQQQQQQHDSYGNQFSTQGTPSSSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSAGQGQPQQQQLPAAQSQPASQPQAAQPSPQQDVYNQYSNAYPASATAATDRRPAGGPQNQFPFQFGRDRVSAPPGSSAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQNTGSATQGPAYHGVNRTDEMLHTDQRANHEGPWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMPNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPTPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRFTKVYSPAHTEEEEEEHLDPKLEEEEEEGVGNDEEMAFLGKDKPSSENNEEKLVSKFDKLPVKIVQRNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKIELLPSRPYVPCPTPPRKHLTTVEGTPGTTEQEGPPPDGLPEKRITATMDDMLSTRSSTLTDEGAKSAEATKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCDKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS DIP protein A2BH40 original sequence version: 38 DIP protein A2BH40 original sequence version: 63 0F14BB1372CC4268 q4kli0_rat SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 Smarcb1 LOC103694876 rCG_60662 protein protein rat Rattus norvegicus (Rat) Rat MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAPAW 6C7233EAFBC389A9 smrc2_human SWI/SNF complex subunit SMARCC2 SMARCC2 BAF170 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 2 SWI/SNF complex 170 kDa subunit BRG1-associated factor 170 protein protein human Homo sapiens Human MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYPVPGNLEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTPEKPRKVHAKWILDTDTFNEWMNEEDYEVNDDKNPVSRRKKISAKTLTDEVNSPDSDRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKTVNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSGLVPLQPKTPQQTSASQQMLNFPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADPAFGLESSGIAGTTSDEPERIEESGNDEARVEGQATDEKKEPKEPREGGGAIEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPIVDPEKEKEPKEGQEEVLKEVVESEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQPPPALPPGSQPIPPTGAAGPPAVHGLAVAPASVVPAPAGSGAPPGSLGPSEQIGQAGSTAGPQQQQPAGAPQPGAVPPGVPPPGPHGPSPFPNQQTPPSMMPGAVPGSGHPGVAGNAPLGLPFGMPPPPPPPAPSIIPFGSLADSISINLPAPPNLHGHHHHLPFAPGTLPPPNLPVSMANPLHPNLPATTTMPSSLPLGPGLGSAAAQSPAIVAAVQGNLLPSASPLPDPGTPLPPDPTAPSPGTVTPVPPPQ DIP protein Q8TAQ2 original sequence version: null DIP protein Q8TAQ2 original sequence version: 76 DIP protein Q8TAQ2 original sequence version: 95 EEFC1042A9296320 smca4_mouse Transcription activator BRG1 Smarca4 Baf190a Brg1 Snf2b Snf2l4 ATP-dependent helicase SMARCA4 BRG1-associated factor 190A Protein brahma homolog 1 SNF2-beta SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4 protein protein mouse Mus musculus Mouse MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPMPTQGPGGYPQDNMHQMHKPMESMHEKGMPDDPRYNQMKGMGMRSGAHTGMAPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGSDPQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPLVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFREYHRSVTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQPAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSEAGSSTPTTSTRSRDKDEESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED DIP protein Q3TKT4 original sequence version: 82 DIP protein Q3TKT4 original sequence version: 56 DIP protein Q3TKT4 original sequence version: 43 DIP protein Q3TKT4 original sequence version: 75 C23804ED858F98FE bmi1_human Polycomb complex protein BMI-1 BMI1 PCGF4 RNF51 Polycomb group RING finger protein 4 RING finger protein 51 protein protein human Homo sapiens Human MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG DIP protein P35226 original sequence version: 105 DIP protein P35226 original sequence version: 136 DIP protein P35226 original sequence version: 110 DIP protein P35226 original sequence version: 129 030A7D396BADA543 smce1_mouse SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 BRG1-associated factor 57 Smarce1 Baf57 protein protein mouse Mus musculus Mouse MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARKRQEEREKEAAEQAERSQSSMAPEEEQVANKAEEKKDEESIPMETEETHLEDTAESQQNGEEGTSTPEDKESGQEGVDSMEVEGTSDSNTGSESNSATVEEPPTDPVPEDEKKE DIP protein O54941 original sequence version: 106 4099B333A0B63709 a4piv7_human SYT-SSX1 protein protein human Homo sapiens Human MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGYQQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQIMPKKPAEDENDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE Q8IZH1 maps to breakpoint 5C71C4366F388A7F acl6a_mouse Actin-like protein 6A Actl6a Actl6 Baf53a 53 kDa BRG1-associated factor A Actin-related protein Baf53a BRG1-associated factor 53A protein protein mouse Mus musculus Mouse MSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVLERDDGSTMMEIDGDKGKQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFEHYSIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELIPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP F3FF706C69808B13 smca4_rat Transcription activator BRG1 Baf190a Smarca4 Brg1 Snf2b Snf2l4 ATP-dependent helicase SMARCA4 SNF2-beta Protein brahma homolog 1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4 BRG1-associated factor 190A protein protein rat Rattus norvegicus (Rat) Rat MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPMPTQGPGGYPQDNMHQMHKPMESMHEKGMPDDPRYNQMKGMGMRSGAHTGMGPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGSDPQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPLVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIVHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFREYHRSVTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQPAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSEAGSSTPTTSTRSRDKDEESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSDEEQEEDRSGSGSEED 7E5F1B04D4C26C87 ari1b_mouse AT-rich interactive domain-containing protein 1B Arid1b BRG1-associated factor 250b Baf250b protein protein mouse Mus musculus Mouse METGLLPNHKLKAVGEAPAAPPHQQHHHHHAHHHHHHHAHHLHHLHHHHALQQQLNQFQQPQPPQPQQQQPPPPPQQQHPTANNSLGGAGGGAPQPGPDMEQPQHGGAKDSVAGNQADPQGQPLLSKPGDEDDAPPKMGEPAGSRYEHPGLGAQQQPAPVAVPGGGGGPAAVSEFNNYYGSAAPASGGPGGRAGPCFDQHGGQQSPGMGMMHSASAAAGAPSSMDPLQNSHEGYPNSQYNHYPGYSRPGAGGGGGGGGGGGGSGGGGGGGGAGGAGGAAAAAAGAGAVAAAAAAAAAAAAAAGGGGGGGYGSSSSGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAGAAAAAGGFQRFAGQNQHPSGATPTLNQLLTSPSPMMRSYGGSYPDYSSSSAPPPPSQPQSQAAAGAAAGGQQAAAGMGLGKDLGAQYAAASPAWAAAQQRSHPAMSPGTPGPTMGRSQGSPMDPMVMKRPQLYGMGTHPHSQPQQSSPYPGGSYGPPGAQRYPLGMQGRAPGALGGLQYPQQQMPPQYGQQAVSGYCQQGQQPYYNQQPQPSHLPPQAQYLQPAAAQSQQRYQPQQDMSQEGYGTRSQPPLAPGKSNHEDLNLIQQERPSSLPDLSGSIDDLPTGTEATLSSAVSASGSTSSQGDQSNPAQSPFSPHASPHLSSIPGGPSPSPVGSPVGSNQSRSGPISPASIPGSQMPPQPPGSQSESSSHPALSQSPMPQERGFMTGTQRNPQMSQYGPQQTGPSMSPHPSPGGQMHPGISNFQQSNSSGTYGPQMSQYGPQGNYSRTPTYSGVPSASYSGPGPGMGINANNQMHGQGPAQPCGAMPLGRMPSAGMQNRPFPGTMSSVTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQSRQGSFPGMNQSGLVASSSPYSQSMNNNSSLMSTQAQPYSMTPTMVNSSTASMGLADMMSPSESKLSVPLKADGKEEGVSQPESKSKDSYGSQGISQPPTPGNLPVPSPMSPSSASISSFHGDESDSISSPGWPKTPSSPKSSSSSTTGEKITKVYELGNEPERKLWVDRYLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKTERGEEPPPEVFSTGDSKKQPKLQPPSPANSGSLQGPQTPQSTGSNSMAEVPGDLKPPTPASTPHGQMTPMQSGRSSTVSVHDPFSDVSDSAYPKRNSMTPNAPYQQGMGMPDMMGRMPYEPNKDPFSGMRKVPGSSEPFMTQGQVPNSGMQDMYNQSPSGAMSNLGMGQRQQFPYGTSYDRRHEAYGQQYPGQGPPTGQPPYGGHQPGLYPQQPNYKRHMDGMYGPPAKRHEGDMYNMQYGSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYNRERMQGPGQMQPHGIPPQMMGGPMQSSSSEGPQQNMWATRNDMPYPYQSRQGPGGPAQAPPYPGMNRTDDMMVPEQRINHESQWPSHVSQRQPYMSSSASMQPITRPPQSSYQTPPSLPNHISRAPSPASFQRSLESRMSPSKSPFLPTMKMQKVMPTVPTSQVTGPPPQPPPIRREITFPPGSVEASQPILKQRRKITSKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVEYFRKCLIDIFGILMEYEVGDPSQKALDHRSGKKDDSQSLEDDSGKEDDDAECLVEEEEEEEEEEEDSEKIESEGKSSPALAAPDASVDPKETPKQASKFDKLPIKIVKKNKLFVVDRSDKLGRVQEFSSGLLHWQLGGGDTTEHIQTHFESKMEIPPRRRPPPPLSSTGKKKELEGKGDSEEQPEKSIIATIDDVLSARPGALPEDTNPGPQTDSGKFPFGIQQAKSHRNIRLLEDEPRSRDETPLCTIAHWQDSLAKRCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATPPFSRQEKFYATLVRYVGDRKNPVCREMSMALLSNLAQGDTLAARAIAVQKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQPPPLEPPSVDMMCRAAKALLAMARVDENRSEFLLHEGRLLDISISAVLNSLVASVICDVLFQIGQL 51AA79A5AE8B30A9 51AA79A5AE8B30A9 ezh2_human Histone-lysine N-methyltransferase EZH2 KMT6 Enhancer of zeste homolog 2 ENX-1 Lysine N-methyltransferase 6 EZH2 protein protein human Homo sapiens Human MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP DIP protein Q15910 original sequence version: 97 DIP protein Q15910 original sequence version: 94 DIP protein Q15910 original sequence version: 92 DIP protein Q15910 original sequence version: 96 DIP protein Q15910 original sequence version: 122 DIP protein Q15910 original sequence version: 100 1B5029EB9D509BE5 snf5_mouse SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 Integrase interactor 1 protein Smarcb1 Ini1 Snf5l1 SNF5 homolog Baf47 BRG1-associated factor 47 protein protein mouse Mus musculus Mouse MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAPAW DIP protein Q9Z0H3 original sequence version: 100 DIP protein Q9Z0H3 original sequence version: 94 B7BCA26875BD943D ssxt_mouse Protein SSXT Ss18 Ssxt Syt Protein SYT Synovial sarcoma-associated Ss18-alpha protein protein mouse Mus musculus Mouse MSVAFAAPRQRGKGEITPAAIQKMLDENNHLIQCIMDYQNKGKASECSQYQQILHTNLVYLATIADSNQNMQSLLPAPPTQTMPMGPGGMSQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPSQLSMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMNMQPNQGPMMHQQPPSQQYNMPPGGAQHYQGQQAPMGLMGQVNQGSHMMGQRQMPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGYQQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQSYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQGQYGNYQQ DIP protein Q62280 original sequence version: 89 FE2BE95EA7396888 sox2_human_gene Transcription factor SOX-2 gene gene gene human Homo sapiens Human a4piv9_human SYT-SSX2 protein protein human Homo sapiens Human MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGYQQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQIMPKKPAEEGNDSEEVPEASGPQNDGKELCPPGKPTTSEKIHERSGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE Q8IZG6 maps to breakpoint 5C71C4366F388A7F actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF DIP protein P60709 original sequence version: null DIP protein P60709 original sequence version: 63 DIP protein P60709 original sequence version: 128 DIP protein P60709 original sequence version: 129 DIP protein P60709 original sequence version: 58 DIP protein P60709 original sequence version: 66 DIP protein P60709 original sequence version: 88 DIP protein P60709 original sequence version: 89 DIP protein P60709 original sequence version: 86 DIP protein P60709 original sequence version: 138 DIP protein P60709 original sequence version: 112 6AFD05CA94E360E2 ssxt_human Protein SSXT SS18 SSXT SYT Synovial sarcoma translocated to X chromosome protein Protein SYT protein protein human Homo sapiens Human MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGYQQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQGQYGNYQQ 7E089D557538252F snf5_human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 SMARCB1 INI1 SNF5L1 Integrase interactor 1 protein BAF47 SNF5 homolog BRG1-associated factor 47 protein protein human Homo sapiens Human MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAPAW B7BCA26875BD943D actl6a-arid1a 16 39 unspecified role unspecified role prey prey 28 unspecified role unspecified role prey prey 40 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait 37 unspecified role unspecified role prey prey 33 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey 35 unspecified role unspecified role prey prey association association Fig. 1A actl6a-arid1a-1 10 39 unspecified role unspecified role prey prey 40 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey 35 unspecified role unspecified role prey prey 28 unspecified role unspecified role prey prey 33 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait 37 unspecified role unspecified role prey prey association association Fig. 1A actl6a-arid1a-2 5 39 unspecified role unspecified role prey prey 35 unspecified role unspecified role prey prey 40 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait 28 unspecified role unspecified role prey prey 37 unspecified role unspecified role prey prey 33 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey association association Fig. 1A smarca4-arid1a-12 13 24 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey 44 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait 45 unspecified role unspecified role prey prey association association Fig. 1B, 2B ss18-arid1a 13 24 unspecified role unspecified role prey prey 45 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 44 unspecified role unspecified role bait bait association association Fig. 1B arid1a-smarcb1 9 39 unspecified role unspecified role neutral component neutral component 28 unspecified role unspecified role neutral component neutral component 40 unspecified role unspecified role neutral component neutral component 31 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 1C bmi1-ezh2 9 32 unspecified role unspecified role neutral component neutral component 38 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 1C smarca4-arid1a-4 12 24 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait 44 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 45 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey association association Fig. 1D 0 smarca4-arid1a-5 12 24 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey 45 unspecified role unspecified role prey prey 44 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey association association Fig. 1D 0.25 smarca4-arid1a-6 12 24 unspecified role unspecified role prey prey 45 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 44 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait association association Fig. 1D 0.75 smarca4-arid1a-7 12 24 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait 44 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 45 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey association association Fig. 1D 1.0 smarca4-arid1a-8 12 24 unspecified role unspecified role prey prey 44 unspecified role unspecified role prey prey 45 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey association association Fig. 1D 1.25 smarca4-arid1a-9 12 24 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 44 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait 30 unspecified role unspecified role prey prey association association Fig. 1D 1.75 smarca4-arid1a-10 12 24 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait 44 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey association association Fig. 1D 2.5 smarca4-arid1a-11 12 44 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait association association Fig. 1D 5 arid1a-smarca4-6 13 24 unspecified role unspecified role bait bait 44 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey association association Supp. Fig. 1A smarcc1-smarca4-2 13 25 unspecified role unspecified role prey prey 44 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait association association Supp. Fig. 1A smarcb1-smarca4 13 45 unspecified role unspecified role bait bait 44 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey association association Supp. Fig. 1A smarca4-arid1a-14 14 24 unspecified role unspecified role prey prey 34 unspecified role unspecified role prey prey 44 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait association association Fig. 2B Presence of the SS18-SSX1 fusion protein appropriate increase in molecular weight of SS18 from 55 kDa to 66 kDa smarca4-arid1a-15 17 24 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait 34 unspecified role unspecified role prey prey 44 unspecified role unspecified role prey prey association association Fig. 2B Presence of the SS18-SSX1 fusion protein appropriate increase in molecular weight of SS18 from 55 kDa to 66 kDa smarca4-arid1a-16 2 24 unspecified role unspecified role neutral component neutral component 30 unspecified role unspecified role neutral component neutral component 25 unspecified role unspecified role neutral component neutral component 44 unspecified role unspecified role neutral component neutral component 34 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 2C, 2D, Supp. Fig. 2D Presence of the SS18-SSX1 fusion protein appropriate increase in molecular weight of SS18 from 55 kDa to 66 kDa. Only a small percentage (2%-8%) of BAF complexes contain the wild-type SS18 protein in these cells however the SS18-SSX fusion protein was almost entirely associated with the BAF complex. smarca4-arid1a-17 18 44 unspecified role unspecified role neutral component neutral component 34 unspecified role unspecified role neutral component neutral component 25 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 2D, Supp. Fig. 2D Presence of the SS18-SSX1 fusion protein appropriate increase in molecular weight of SS18 from 55 kDa to 66 kDa. Only a small percentage (2-8%) of BAF complexes contain the wild-type SS18 protein in these cells however the SS18-SSX fusion protein was almost entirely associated with the BAF complex. smarca4-ssxt-1 4 31 unspecified role unspecified role bait bait 23 unspecified role unspecified role prey prey intronic region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig 2C ss18-smarca4 1 25 unspecified role unspecified role prey prey 45 unspecified role unspecified role prey prey 44 unspecified role unspecified role bait bait n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain association association Fig. 5A ss18_ssx1_fu-smarca4 1 25 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 3B, 5A, Supp. Fig. 5A smarca4-arid1a-18 6 44 unspecified role unspecified role neutral component neutral component 34 unspecified role unspecified role neutral component neutral component 25 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 3F smarca4-smarcb1-2 6 45 unspecified role unspecified role neutral component neutral component 25 unspecified role unspecified role neutral component neutral component 44 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 3F smarcc1-sox2 15 20 unspecified role unspecified role bait bait 41 unspecified role unspecified role prey prey tf1 binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tf2 binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4F SS18-SSX1-infected primary human fibroblasts demonstrated a significant increase in BAF complex occupancy at all three sites within the Sox2 locus as compared to control fibroblasts ss18-sox2 15 44 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 41 unspecified role unspecified role prey prey tf2 binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tf1 binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig. 4C The 78 aa SSX fragment did not localize to the Sox2 locus ss18_ssx1_fusio-sox2 15 41 unspecified role unspecified role prey prey tf2 binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tf1 binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 34 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig. 4C The 78 aa SSX fragment did not localize to the Sox2 locus ss18_ssx1_-smarca4-1 1 34 unspecified role unspecified role bait bait A4PIV7:p.Lys453_Arg454delinsMetIle mutation mutation certain certain sequence position certain certain certain sequence position certain KR MI Thu Jul 07 12:18:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was lys453met_arg454ile Fri Jul 22 11:09:27 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys453met,arg454ile' Wed May 02 15:10:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys_arg453-454met_ile' Tue Jun 30 16:54:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys453_Arg454delinsMetIle' n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 45 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey association association Fig. 5A, 5E, 5F ss18_ssx1_-smarca4-2 1 25 unspecified role unspecified role prey prey 42 unspecified role unspecified role bait bait n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp. Fig. 5A, ss18_ssx1_-smarca4-3 1 27 unspecified role unspecified role bait bait n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 25 unspecified role unspecified role prey prey physical association physical association Supp. Fig. 5A, smarca4-smarcb1-3 13 45 unspecified role unspecified role prey prey 44 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait association association Fig. 6A SS18 and SS18-SSX are both stably bound to BAF complexes and dissociate to comparable degrees using 0 to 8 M urea. smarca4-smarcb1-8 14 34 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait physical association physical association Fig. 6A, 6D SS18-SSX1 is stably bound to BAF complexes which dissociate from 0 - 8 M urea. Transfection of these cells with wild-type SSTX (V5-tagged) restored binding to SMARCB1 smarca4-actb-1 11 24 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 44 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 45 unspecified role unspecified role prey prey 43 unspecified role unspecified role prey prey association association Fig. 6C 1.0 smarca4-actb-2 11 24 unspecified role unspecified role prey prey 43 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 44 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 6C 2.5 ss18-actb 11 24 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 45 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 44 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 43 unspecified role unspecified role prey prey association association Fig. 6C 0 ss18_ssx1_fusio-actb 3 24 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 43 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey association association Fig. 6C 0 ss18-actb-1 11 25 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 44 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 43 unspecified role unspecified role prey prey association association Fig. 6C 5 ss18_ssx1_fus-actb-1 3 24 unspecified role unspecified role prey prey 43 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role prey prey association association Fig. 6C 0.25 smarca4-actb 11 24 unspecified role unspecified role prey prey 43 unspecified role unspecified role prey prey 45 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 44 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 6C 0.25 ss18_ssx1_fus-actb-1 3 24 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 43 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey association association Fig. 6C 1 ss18_ssx1_fus-actb-2 3 24 unspecified role unspecified role prey prey 43 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey association association Fig. 6C 2.5 ss18_ssx1_fus-actb-3 3 34 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 43 unspecified role unspecified role prey prey association association Fig. 6C 5 smarcc1-sox2-1 7 20 unspecified role unspecified role bait bait 41 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tf1 binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tf2 binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 6H Aska-SS cells infected with SS18 FL to reverse the BAF complex phenotype exhibited a dramatically decreased occupancy of BAF complexes at the human Sox2 locus with a concomitant increase in H3K27me3 occupancy smarca4-arid1a-20 17 25 unspecified role unspecified role bait bait 34 unspecified role unspecified role prey prey physical association physical association Fig. 7A, Supp. Fig. 6 SS18-SSX stably bound to BAF complexes and dissociated as the urea concentration increased. smarca4-smarcb1-5 13 45 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 45 unspecified role unspecified role prey prey 44 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait association association Fig. 7A smarca4-smarcb1-7 19 36 unspecified role unspecified role bait bait 29 unspecified role unspecified role prey prey 45 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role prey prey association association smarcb1-ss18_ssx1_fu 1 45 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role prey prey physical association physical association Fig. 7A smarcb1-smarca4-1 8 36 unspecified role unspecified role prey prey 45 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 7A smarca4-smarcb1-10 14 45 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey association association Fig. 7B overexpression of SS18 FL or KD (knock down) of the SS18-SSX fusion resulted in increased incorporation and stabilization of BAF47-V5 smarca4-smarcb1-11 14 25 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey 45 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 45 unspecified role unspecified role prey prey association association Fig. 7B overexpression of SS18 FL or KD (knock down) of the SS18-SSX fusion resulted in increased incorporation and stabilization of BAF47-V5 smarca4-smarcb1-12 17 20 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait physical association physical association Fig. 7B overexpression of SS18 FL or KD (knock down) of the SS18-SSX fusion resulted in increased incorporation and stabilization of BAF47-V5 smarca4-smarcb1-13 17 25 unspecified role unspecified role bait bait 45 unspecified role unspecified role prey prey 45 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role prey prey association association Fig. 7B, overexpression of SS18 FL or KD (knock down) of the SS18-SSX fusion resulted in increased incorporation and stabilization of BAF47-V5 smarca4-smarcb1-14 14 45 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait 44 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6D SS18-SSX1 is stably bound to BAF complexes which dissociate from 0 - 8 M urea. Transfection of these cells with wild-type SSTX (V5-tagged) restored binding to SMARCB1