MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it NMR mapping of RANTES surfaces interacting with CCR5 using linked extracellular domains. NMR mapping of RANTES surfaces interacting with CCR5 using linked extracellular domains. FEBS J. (1742-464X) 2013 Schnur E., Kessler N., Zherdev Y., Noah E., Scherf T., Ding FX., Rabinovich S., Arshava B., Kurbatska V., Leonciks A., Tsimanis A., Rosen O., Naider F., Anglister J. suggested by lperfetto in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr experimental particp experimental participant identification experimental particp Schnur E., Kessler N., Zherdev Y., Noah E., Scherf T., Ding FX., Rabinovich S., Arshava B., Kurbatska V., Leonciks A., Tsimanis A., Rosen O., Naider F., Anglister J. suggested by lperfetto FEBS J. (1742-464X) 2013 ccl5_human C-C motif chemokine 5 CCL5 D17S136E SCYA5 EoCP Eosinophil chemotactic cytokine SIS-delta Small-inducible cytokine A5 T cell-specific protein P228 T-cell-specific protein RANTES protein protein human Homo sapiens Human MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS DIP protein P13501 original sequence version: 123 DIP protein P13501 original sequence version: 133 DIP protein P13501 original sequence version: 170 FB0BFAF9A87C620F ccr5_human C-C chemokine receptor type 5 HIV-1 fusion coreceptor CHEMR13 CCR5 CMKBR5 protein protein human Homo sapiens Human MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL DIP protein P51681 original sequence version: 108 DIP protein P51681 original sequence version: 130 88ECE1F38E6D45A7 ccl5-ccr5 1 Nt-ECL1-ECL2 3 peptide synthesis peptide synthesis experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Stoichiometry: 1.2 RANTES 2 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint f2 f5 ccl5-1 1 RANTES 2 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Stoichiometry: 2.0 direct interaction direct interaction f1 mint ccl5-ccr5-1 1 Nt-CCR5 3 peptide synthesis peptide synthesis experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified sulfotyrosine osulftyr O4'-sulfo-L-tyrosine (S)-2-amino-3-(4-sulfooxyphenyl)propanoic acid MOD_RES Sulfotyrosine O4-sulfotyrosine tyrosine sulfate tyrosine-O-sulfonic acid tyrosine-O-sulphonic acid 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-sulfate O4'-sulfo-L-tyrosine O-Sulfonation OSulfTyr Sulfo Sulphation (of O of Tyrosine) Tyrosinyl Sulphate sulfationy certain certain sequence position certain certain certain sequence position certain prerequisite-ptm sulfotyrosine osulftyr O4'-sulfo-L-tyrosine (S)-2-amino-3-(4-sulfooxyphenyl)propanoic acid MOD_RES Sulfotyrosine O4-sulfotyrosine tyrosine sulfate tyrosine-O-sulfonic acid tyrosine-O-sulphonic acid 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-sulfate O4'-sulfo-L-tyrosine O-Sulfonation OSulfTyr Sulfo Sulphation (of O of Tyrosine) Tyrosinyl Sulphate sulfationy certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain RANTES 2 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint Nt-CCR5 binds both the monomeric and dimeric forms of RANTES. To obtain a rough estimate of the KD we had to assume a constant concentration of monomeric and dimeric RANTES (although, as mentioned above, this assumption is not correct). A rough KD estimate of 16 and 100 microM for the monomeric and dimeric form, respectively, was obtained (Fig. 4). f3 f4b f5a ccl5-ccr5-2 1 Nt-CCR5 3 peptide synthesis peptide synthesis experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified sulfotyrosine osulftyr O4'-sulfo-L-tyrosine (S)-2-amino-3-(4-sulfooxyphenyl)propanoic acid MOD_RES Sulfotyrosine O4-sulfotyrosine tyrosine sulfate tyrosine-O-sulfonic acid tyrosine-O-sulphonic acid 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-sulfate O4'-sulfo-L-tyrosine O-Sulfonation OSulfTyr Sulfo Sulphation (of O of Tyrosine) Tyrosinyl Sulphate sulfationy certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain sulfotyrosine osulftyr O4'-sulfo-L-tyrosine (S)-2-amino-3-(4-sulfooxyphenyl)propanoic acid MOD_RES Sulfotyrosine O4-sulfotyrosine tyrosine sulfate tyrosine-O-sulfonic acid tyrosine-O-sulphonic acid 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-sulfate O4'-sulfo-L-tyrosine O-Sulfonation OSulfTyr Sulfo Sulphation (of O of Tyrosine) Tyrosinyl Sulphate sulfationy certain certain sequence position certain certain certain sequence position certain prerequisite-ptm Stoichiometry: 1.2 RANTES 2 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Stoichiometry: 2.1 direct interaction direct interaction homomint mint Nt-CCR5 binds both the monomeric and dimeric forms of RANTES. To obtain a rough estimate of the KD we had to assume a constant concentration of monomeric and dimeric RANTES (although, as mentioned above, this assumption is not correct). A rough KD estimate of 16 and 100 microM for the monomeric and dimeric form, respectively, was obtained (Fig. 4). f3 f4a f5a ccl5-ccr5-3 1 RANTES 2 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ECL1-ECL2 3 peptide synthesis peptide synthesis experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f6 homomint mint A KD of 2.3 ± 0.3 mM was determined for the ECL1-ECL2/RANTES complex (Fig. 6C).