MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Beclin-1 is required for chromosome congression and proper outer kinetochore assembly. Beclin-1 is required for chromosome congression and proper outer kinetochore assembly. EMBO Rep. (1469-221X) 2013 imex curation Frémont S., Gérard A., Galloux M., Janvier K., Karess R.E., Berlioz-Torrent C. clarisse.berlioz@inserm.fr 26-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Frémont S., Gérard A., Galloux M., Janvier K., Karess R.E., Berlioz-Torrent C. clarisse.berlioz@inserm.fr Accepted 2013-JUN-20 by ORCHARD 26-Jun-2013: Contacted by IntAct-Help. EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation Beclin-1 is required for chromosome congression and proper outer kinetochore assembly. Beclin-1 is required for chromosome congression and proper outer kinetochore assembly. EMBO Rep. (1469-221X) 2013 imex curation Frémont S., Gérard A., Galloux M., Janvier K., Karess R.E., Berlioz-Torrent C. clarisse.berlioz@inserm.fr 26-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Frémont S., Gérard A., Galloux M., Janvier K., Karess R.E., Berlioz-Torrent C. clarisse.berlioz@inserm.fr Accepted 2013-JUN-20 by ORCHARD 26-Jun-2013: Contacted by IntAct-Help. EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation Beclin-1 is required for chromosome congression and proper outer kinetochore assembly. Beclin-1 is required for chromosome congression and proper outer kinetochore assembly. EMBO Rep. (1469-221X) 2013 imex curation Frémont S., Gérard A., Galloux M., Janvier K., Karess R.E., Berlioz-Torrent C. clarisse.berlioz@inserm.fr 26-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Frémont S., Gérard A., Galloux M., Janvier K., Karess R.E., Berlioz-Torrent C. clarisse.berlioz@inserm.fr Accepted 2013-JUN-20 by ORCHARD 26-Jun-2013: Contacted by IntAct-Help. EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation zwint_human ZW10 interactor ZW10-interacting protein 1 ZWINT protein protein human Homo sapiens Human MEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAKILVEFVVDSQKKDKLLCSQLQVADFLQNILAQEDTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQMEEAQRKRTQLREAFEQLQAKKQMAMEKRRAVQNQWQLQQEKHLQHLAEVSAEVRERKTGTQQELDRVFQKLGNLKQQAEQERDKLQRYQTFLQLLYTLQGKLLFPEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVNLP 3335FBA5731AD0DC becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK DIP protein Q14457 original sequence version: 95 DIP protein Q14457 original sequence version: 156 DIP protein Q14457 original sequence version: 122 DIP protein Q14457 original sequence version: 120 DIP protein Q14457 original sequence version: 133 DIP protein Q14457 original sequence version: 141 DIP protein Q14457 original sequence version: 106 ABF0C2DD7087473C zwint-becn1 1 Zwint-1 4 unspecified role unspecified role bait bait living cell living cell 5 unspecified role unspecified role prey prey living cell living cell tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5a zwint-becn1-1 2 4 unspecified role unspecified role bait bait purified purified tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 5 unspecified role unspecified role prey prey purified purified tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction f5b becn1-zwint 3 4 unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell 5 unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell colocalization colocalization f5f becn1-zwint-1 3 4 unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell 5 unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell tag mcherry mcherry fluorescent protein tag mcherry undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization f5g