MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it HIV-1 envelope trimer has similar binding characteristics for carbohydrate-binding agents as monomeric gp120. HIV-1 envelope trimer has similar binding characteristics for carbohydrate-binding agents as monomeric gp120. FEBS Lett. (0014-5793) 2013 Hoorelbeke B., van Montfort T., Xue J., LiWang PJ., Tanaka H., Igarashi Y., Van Damme EJ., Sanders RW., Balzarini J. bart.hoorelbeke@rega.kuleuven.be in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Hoorelbeke B., van Montfort T., Xue J., LiWang PJ., Tanaka H., Igarashi Y., Van Damme EJ., Sanders RW., Balzarini J. bart.hoorelbeke@rega.kuleuven.be FEBS Lett. (0014-5793) 2013 ahv_actsk Actinohivin ath protein protein actsk Actinomycete sp. (strain K97-0003) MNTLTKLTIGAVALTGSFLAAAPASAAPAADTTASPALGSQVSAQFASVTIRNAQTGRLLDSNYNGNVYTLPANGGNYQRWTGPGDGTVRNAQTGRCLDSNYDGAVYTLPCNGGSYQKWLFYSNGYIQNVETGRVLDSNYNGNVYTLPANGGNYQKWYTG mint 37F269BD16106240 grfin_grisq Griffithsin protein protein grisq Griffithsia sp. (strain Q66D336) SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDXIIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY DIP protein P84801 original sequence version: 13 DIP protein P84801 original sequence version: 14 mint F89843AF6DE5049D agi_urtdi Lectin/endochitinase 1 UDA1 Agglutinin UDA chia5.1.1 protein protein urtdi Urtica dioica MMMRFLSAVVIMSSAMAVGLVSAQRCGSQGGGGTCPALWCCSIWGWCGDSEPYCGRTCENKCWSGERSDHRCGAAVGNPPCGQDRCCSVHGWCGGGNDYCSGSKCQYRCSSSVRGPRVALSGNSTANSIGNVVVTEPLFDQMFSHRKDCPSQGFYSYHSFLVAAESFPAFGTIGDVATRKREVAAFLAHISQATSGERSDVENPHAWGLCHINTTTVTENDFCTSSDWPCAAGKKYSPRGPIQLTHNFNYGLAGQAIGEDLIQNPDLVEKDPIISFKTALWFWMSQHDNKPSCHDIVLNANSAANRIPNKGVIGNIISRAFGHDDFAVRSSSIGFYKRYCDMLGVSYGHDLKYWFDNTPSSEFQRIQMRVAA mint 28E9A2312BF08FD2 q75760_9hiv1 Envelope glycoprotein gp160 env Env polyprotein protein protein 9hiv1 Human immunodeficiency virus 1 MRVKGIRKSYQYLWKGGTLLLGILMICSAVEKLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLENVTEHFNMWKNNMVEQMQEDIISLWDQSLKPCVKLTPLCVTLNCKDVNATNTTNDSEGTMERGEIKNCSFNITTSIRDEVQKEYALFYKLDVVPIDNNNTSYRLISCDTSVITQACPKISFEPIPIHYCAPAGFAILKCNDKTFNGKGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTIIVQLKESVEINCTRPNNNTRKSIHIGPGRAFYTTGEIIGDIRQAHCNISRAKWNDTLKQIVIKLREQFENKTIVFNHSSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWNNNTEGSNNTEGNTITLPCRIKQIINMWQEVGKAMYAPPIRGQIRCSSNITGLLLTRDGGINENGTEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARLLLSGIVQQQNNLLRAIEAQQRMLQLTVWGIKQLQARVLAVERYLGDQQLLGIWGCSGKLICTTAVPWNASWSNKSLDRIWNNMTWMEWEREIDNYTSEIYTLIEESQNQQEKNEQELLELDKWASLWNWFDITKWLWYIKIFIMIVGGLVGLRLVFTVLSIVNRVRQGYSPLSFQTLLPAPRGPDRPEGIEEEGGERDRDRSGRLVNGFLALIWVDLRSLCLFSYHRLRDLLLTVTRIVELLGRRGWEVLKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRIIEALQRTYRAILHIPTRIRQGLERALL DIP protein Q75760 original sequence version: 120 DIP protein Q75760 original sequence version: 86 mint 022D5F24E04FB29F env-ath 1 gp120 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain AH 2 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified direct interaction direct interaction t1 mint We also wanted to investigate the affinity of the test compounds against monomeric (gp120Man5-9) and trimeric (gp140Man5-9) Env that consisted of a less heterogenic glycan shield lacking complex-type glycans and solely containing mannosylated glycans. The exclusive presence of Man5-9 oligomannose glycans on gp120Man5-9 and gp140Man5-9 resulted in consistently lower KD values for those CBAs that were predominantly α1,2-mannose-specific (i.e. CBAs AH, GRFT, PRM-S) and for the α1,2-mannose-directed Ab 2G12. The p-values for the higher affinity interactions of the α1,2- mannose-specific CBA agents gp120Man5-9 and gp140Man5-9 versus wild-type gp120WT and gp140WT were 0.010 (AH); 0.007 (GRFT), 0.026 (PRM-S) and 0.001 (Ab 2G12), respectively. No such significant change in KD values was detected for the 1,3/1,6-mannose-specific HHA, the GlcNAcspecific UDA, Ab b12, sCD4 and DC-SIGN (p-values: >> 0.05) (Table 1). env-ath-1 1 AH 2 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified Stoichiometry: 1.3 gp140 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Stoichiometry: 3.1 direct interaction direct interaction t1 mint We also wanted to investigate the affinity of the test compounds against monomeric (gp120Man5-9) and trimeric (gp140Man5-9) Env that consisted of a less heterogenic glycan shield lacking complex-type glycans and solely containing mannosylated glycans. The exclusive presence of Man5-9 oligomannose glycans on gp120Man5-9 and gp140Man5-9 resulted in consistently lower KD values for those CBAs that were predominantly α1,2-mannose-specific (i.e. CBAs AH, GRFT, PRM-S) and for the α1,2-mannose-directed Ab 2G12. The p-values for the higher affinity interactions of the α1,2- mannose-specific CBA agents gp120Man5-9 and gp140Man5-9 versus wild-type gp120WT and gp140WT were 0.010 (AH); 0.007 (GRFT), 0.026 (PRM-S) and 0.001 (Ab 2G12), respectively. No such significant change in KD values was detected for the 1,3/1,6-mannose-specific HHA, the GlcNAcspecific UDA, Ab b12, sCD4 and DC-SIGN (p-values: >> 0.05) (Table 1). env-grfin 1 gp120 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GRFT 3 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified direct interaction direct interaction mint t1 f3 We also wanted to investigate the affinity of the test compounds against monomeric (gp120Man5-9) and trimeric (gp140Man5-9) Env that consisted of a less heterogenic glycan shield lacking complex-type glycans and solely containing mannosylated glycans. The exclusive presence of Man5-9 oligomannose glycans on gp120Man5-9 and gp140Man5-9 resulted in consistently lower KD values for those CBAs that were predominantly α1,2-mannose-specific (i.e. CBAs AH, GRFT, PRM-S) and for the α1,2-mannose-directed Ab 2G12. The p-values for the higher affinity interactions of the α1,2- mannose-specific CBA agents gp120Man5-9 and gp140Man5-9 versus wild-type gp120WT and gp140WT were 0.010 (AH); 0.007 (GRFT), 0.026 (PRM-S) and 0.001 (Ab 2G12), respectively. No such significant change in KD values was detected for the 1,3/1,6-mannose-specific HHA, the GlcNAcspecific UDA, Ab b12, sCD4 and DC-SIGN (p-values: >> 0.05) (Table 1). env-grfin-1 1 gp140 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Stoichiometry: 3.1 GRFT 3 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified Stoichiometry: 1.3 direct interaction direct interaction mint t1 f3 We also wanted to investigate the affinity of the test compounds against monomeric (gp120Man5-9) and trimeric (gp140Man5-9) Env that consisted of a less heterogenic glycan shield lacking complex-type glycans and solely containing mannosylated glycans. The exclusive presence of Man5-9 oligomannose glycans on gp120Man5-9 and gp140Man5-9 resulted in consistently lower KD values for those CBAs that were predominantly α1,2-mannose-specific (i.e. CBAs AH, GRFT, PRM-S) and for the α1,2-mannose-directed Ab 2G12. The p-values for the higher affinity interactions of the α1,2- mannose-specific CBA agents gp120Man5-9 and gp140Man5-9 versus wild-type gp120WT and gp140WT were 0.010 (AH); 0.007 (GRFT), 0.026 (PRM-S) and 0.001 (Ab 2G12), respectively. No such significant change in KD values was detected for the 1,3/1,6-mannose-specific HHA, the GlcNAcspecific UDA, Ab b12, sCD4 and DC-SIGN (p-values: >> 0.05) (Table 1). env-uda1 1 gp120 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain UDA 4 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified direct interaction direct interaction t1 mint We also wanted to investigate the affinity of the test compounds against monomeric (gp120Man5-9) and trimeric (gp140Man5-9) Env that consisted of a less heterogenic glycan shield lacking complex-type glycans and solely containing mannosylated glycans. The exclusive presence of Man5-9 oligomannose glycans on gp120Man5-9 and gp140Man5-9 resulted in consistently lower KD values for those CBAs that were predominantly α1,2-mannose-specific (i.e. CBAs AH, GRFT, PRM-S) and for the α1,2-mannose-directed Ab 2G12. The p-values for the higher affinity interactions of the α1,2- mannose-specific CBA agents gp120Man5-9 and gp140Man5-9 versus wild-type gp120WT and gp140WT were 0.010 (AH); 0.007 (GRFT), 0.026 (PRM-S) and 0.001 (Ab 2G12), respectively. No such significant change in KD values was detected for the 1,3/1,6-mannose-specific HHA, the GlcNAcspecific UDA, Ab b12, sCD4 and DC-SIGN (p-values: >> 0.05) (Table 1). env-uda1-1 1 gp140 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Stoichiometry: 3.1 UDA 4 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified Stoichiometry: 1.3 direct interaction direct interaction t1 mint We also wanted to investigate the affinity of the test compounds against monomeric (gp120Man5-9) and trimeric (gp140Man5-9) Env that consisted of a less heterogenic glycan shield lacking complex-type glycans and solely containing mannosylated glycans. The exclusive presence of Man5-9 oligomannose glycans on gp120Man5-9 and gp140Man5-9 resulted in consistently lower KD values for those CBAs that were predominantly α1,2-mannose-specific (i.e. CBAs AH, GRFT, PRM-S) and for the α1,2-mannose-directed Ab 2G12. The p-values for the higher affinity interactions of the α1,2- mannose-specific CBA agents gp120Man5-9 and gp140Man5-9 versus wild-type gp120WT and gp140WT were 0.010 (AH); 0.007 (GRFT), 0.026 (PRM-S) and 0.001 (Ab 2G12), respectively. No such significant change in KD values was detected for the 1,3/1,6-mannose-specific HHA, the GlcNAcspecific UDA, Ab b12, sCD4 and DC-SIGN (p-values: >> 0.05) (Table 1).