MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A direct proofreader-clamp interaction stabilizes the Pol III replicase in the polymerization mode. A direct proofreader-clamp interaction stabilizes the Pol III replicase in the polymerization mode. EMBO J. (0261-4189) 2013 imex curation Jergic S., Horan N.P., Elshenawy M.M., Mason C.E., Urathamakul T., Ozawa K., Robinson A., Goudsmits J.M., Wang Y., Pan X., Beck J.L., van Oijen A.M., Huber T., Hamdan S.M., Dixon N.E. nickd@uow.edu.au 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Jergic S., Horan N.P., Elshenawy M.M., Mason C.E., Urathamakul T., Ozawa K., Robinson A., Goudsmits J.M., Wang Y., Pan X., Beck J.L., van Oijen A.M., Huber T., Hamdan S.M., Dixon N.E. nickd@uow.edu.au Accepted 2013-JUN-27 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation A direct proofreader-clamp interaction stabilizes the Pol III replicase in the polymerization mode. A direct proofreader-clamp interaction stabilizes the Pol III replicase in the polymerization mode. EMBO J. (0261-4189) 2013 imex curation Jergic S., Horan N.P., Elshenawy M.M., Mason C.E., Urathamakul T., Ozawa K., Robinson A., Goudsmits J.M., Wang Y., Pan X., Beck J.L., van Oijen A.M., Huber T., Hamdan S.M., Dixon N.E. nickd@uow.edu.au 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Jergic S., Horan N.P., Elshenawy M.M., Mason C.E., Urathamakul T., Ozawa K., Robinson A., Goudsmits J.M., Wang Y., Pan X., Beck J.L., van Oijen A.M., Huber T., Hamdan S.M., Dixon N.E. nickd@uow.edu.au Accepted 2013-JUN-27 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation A direct proofreader-clamp interaction stabilizes the Pol III replicase in the polymerization mode. A direct proofreader-clamp interaction stabilizes the Pol III replicase in the polymerization mode. EMBO J. (0261-4189) 2013 imex curation Jergic S., Horan N.P., Elshenawy M.M., Mason C.E., Urathamakul T., Ozawa K., Robinson A., Goudsmits J.M., Wang Y., Pan X., Beck J.L., van Oijen A.M., Huber T., Hamdan S.M., Dixon N.E. nickd@uow.edu.au 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Jergic S., Horan N.P., Elshenawy M.M., Mason C.E., Urathamakul T., Ozawa K., Robinson A., Goudsmits J.M., Wang Y., Pan X., Beck J.L., van Oijen A.M., Huber T., Hamdan S.M., Dixon N.E. nickd@uow.edu.au Accepted 2013-JUN-27 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation hole_ecoli DNA polymerase III subunit theta holE b1842 JW1831 protein protein ecoli Escherichia coli (strain K12) MLKNLAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLPYEPKLK 3667D87327E96556 3667D87327E96556 dpo3b_ecoli Beta sliding clamp dnaN Beta-clamp processivity factor DNA polymerase III beta sliding clamp subunit JW3678 b3701 protein protein ecoli Escherichia coli (strain K12) MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALVQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMRL DIP protein P0A988 original sequence version: 48 This sequence has been withdrawn from Uniprot. 7A45646F61255B5A dpo3e_ecoli DNA polymerase III subunit epsilon dnaQ mutD b0215 JW0205 protein protein ecoli Escherichia coli (strain K12) MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVYLAMTGGQTSMAFAMEGETQQQQGEATIQRIVRQASKLRVVFATDEEIAAHEARLDLVQKKGGSCLWRA DIP protein P03007 original sequence version: 106 DIP protein P03007 original sequence version: null 4211C9A00744964F dpo3a_ecoli DNA polymerase III subunit alpha dnaE polC b0184 JW0179 protein protein ecoli Escherichia coli (strain K12) MSEPRFVHLRVHSDYSMIDGLAKTAPLVKKAAALGMPALAITDFTNLCGLVKFYGAGHGAGIKPIVGADFNVQCDLLGDELTHLTVLAANNTGYQNLTLLISKAYQRGYGAAGPIIDRDWLIELNEGLILLSGGRMGDVGRSLLRGNSALVDECVAFYEEHFPDRYFLELIRTGRPDEESYLHAAVELAEARGLPVVATNDVRFIDSSDFDAHEIRVAIHDGFTLDDPKRPRNYSPQQYMRSEEEMCELFADIPEALANTVEIAKRCNVTVRLGEYFLPQFPTGDMSTEDYLVKRAKEGLEERLAFLFPDEEERLKRRPEYDERLETELQVINQMGFPGYFLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSMPDFDVDFCMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLIPPDPGMTLAKAFEAEPQLPEIYEADEEVKALIDMARKLEGVTRNAGKHAGGVVIAPTKITDFAPLYCDEEGKHPVTQFDKSDVEYAGLVKFDFLGLRTLTIINWALEMINKRRAKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALVALFRPGPLQSGMVDNFIDRKHGREEISYPDVQWQHESLKPVLEPTYGIILYQEQVMQIAQVLSGYTLGGADMLRRAMGKKKPEEMAKQRSVFAEGAEKNGINAELAMKIFDLVEKFAGYGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKILPPDINSGLYHFHVNDDGEIVYGIGAIKGVGEGPIEAIIEARNKGGYFRELFDLCARTDTKKLNRRVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQADMFGVLAEEPEQIEQSYASCQPWPEQVVLDGERETLGLYLTGHPINQYLKEIERYVGGVRLKDMHPTERGKVITAAGLVVAARVMVTKRGNRIGICTLDDRSGRLEVMLFTDALDKYQQLLEKDRILIVSGQVSFDDFSGGLKMTAREVMDIDEAREKYARGLAISLTDRQIDDQLLNRLRQSLEPHRSGTIPVHLYYQRADARARLRFGATWRVSPSDRLLNDLRGLIGSEQVELEFD DIP protein P10443 original sequence version: 103 DIP protein P10443 original sequence version: null 1A4F75F373841716 dnan-dnaq 2 Epsilon 6 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P03007:p.Gln182Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A Wed May 02 19:55:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln182ala' Tue Jun 30 16:51:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln182Ala' peptide sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) Beta 5 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction figure 3A, Supplementary Figure 3A dnaq-dnan 2 Beta 5 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) Epsilon 6 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined peptide sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain P03007:p.[Thr183Leu;Met185_Phe187delinsProLeuPro] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T L certain certain sequence position certain certain certain sequence position certain MAF PLP Thu Jul 07 12:15:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was thr183leu_met185pro_ala186leu_phe187pro Fri Jul 22 11:00:45 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'thr183leu,met185pro,ala186leu,phe187pro' Wed May 02 15:21:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr183leu,met_ala_phe185-187pro_leu_pro' Tue Jun 30 20:21:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr183Leu;Met185_Phe187delinsProLeuPro]' direct interaction direct interaction figure 3A, Supplementary Figure 3A dnan-dnaq-1 3 Beta 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Epsilon 6 unspecified role unspecified role neutral component neutral component purified purified P03007:p.Gln182Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A Wed May 02 14:38:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln182ala' Tue Jun 30 18:42:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln182Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction figure 3B dnan-dnaq-2 3 Epsilon 6 unspecified role unspecified role neutral component neutral component purified purified P03007:p.[Thr183Leu;Met185_Phe187delinsProLeuPro] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T L certain certain sequence position certain certain certain sequence position certain MAF PLP Thu Jul 07 12:07:36 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was thr183leu_met185pro_ala186leu_phe187pro Fri Jul 22 11:04:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'thr183leu,met185pro,ala186leu,phe187pro' Wed May 02 18:12:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr183leu,met_ala_phe185-187pro_leu_pro' Tue Jun 30 18:14:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr183Leu;Met185_Phe187delinsProLeuPro]' ecoli Escherichia coli (strain K12) Beta 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction figure 3B dnae-dnan-1 3 Theta 4 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Epsilon 6 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Beta 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) alpha 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association figure 3C dnan-dnaq-4 3 alpha 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Beta 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Epsilon 6 unspecified role unspecified role neutral component neutral component purified purified P03007:p.[Thr183Leu;Met185_Phe187delinsProLeuPro] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T L certain certain sequence position certain certain certain sequence position certain MAF PLP Thu Jul 07 12:16:21 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was thr183leu_met185pro_ala186leu_phe187pro Fri Jul 22 10:53:44 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'thr183leu,met185pro,ala186leu,phe187pro' Wed May 02 20:26:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr183leu,met_ala_phe185-187pro_leu_pro' Tue Jun 30 17:57:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr183Leu;Met185_Phe187delinsProLeuPro]' ecoli Escherichia coli (strain K12) Theta 4 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association figure 3C dnae-dnan-2 3 alpha 7 unspecified role unspecified role neutral component neutral component purified purified P10443:p.[Ala921Leu;Met923Leu] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A L certain certain sequence position certain certain certain sequence position certain M L Wed May 02 14:30:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala921leu,met923leu' Tue Jun 30 16:51:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala921Leu;Met923Leu]' ecoli Escherichia coli (strain K12) Beta 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Epsilon 6 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Theta 4 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association figure 4b, supplementary Figure 4 dnae-dnan-3 3 Beta 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) alpha 7 unspecified role unspecified role neutral component neutral component purified purified P10443:p.[Ala921Leu;Met923Leu] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A L certain certain sequence position certain certain certain sequence position certain M L Wed May 02 17:24:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala921leu,met923leu' Tue Jun 30 18:44:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala921Leu;Met923Leu]' ecoli Escherichia coli (strain K12) direct interaction direct interaction figure 4a dnan-1 1 Beta 5 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction Supplementary Figure 3B dnan-1 3 Beta 5 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Supplementary Figure 2C, Supplementary Figure 2D dnan-1 3 Beta 5 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction Supplementary Figure 2A dnan-dnaq-6 1 Beta 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Epsilon 6 unspecified role unspecified role neutral component neutral component purified purified P03007:p.[Thr183Leu;Met185_Phe187delinsProLeuPro] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T L certain certain sequence position certain certain certain sequence position certain MAF PLP Thu Jul 07 12:18:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was thr183leu_met185pro_ala186leu_phe187pro Fri Jul 22 10:56:46 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'thr183leu,met185pro,ala186leu,phe187pro' Wed May 02 15:38:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr183leu,met_ala_phe185-187pro_leu_pro' Tue Jun 30 16:36:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr183Leu;Met185_Phe187delinsProLeuPro]' ecoli Escherichia coli (strain K12) direct interaction direct interaction supp. figure 3B dnae-dnan-mutant 3 Epsilon 6 unspecified role unspecified role neutral component neutral component purified purified P03007:p.Gln182Ala mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A Wed May 02 18:30:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln182ala' Tue Jun 30 18:38:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln182Ala' ecoli Escherichia coli (strain K12) Theta 4 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) alpha 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association figure 3C