MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Reaper homologue IBM1 in silkworm Bombyx mori induces apoptosis upon baculovirus infection. Reaper homologue IBM1 in silkworm Bombyx mori induces apoptosis upon baculovirus infection. FEBS Lett. (0014-5793) 2013 Wu Y., Wu Y., Hui T., Wu H., Wu Y., Wang W. bommo-bmn Bombyx mori bmn bmn fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Wu Y., Wu Y., Hui T., Wu H., Wu Y., Wang W. FEBS Lett. (0014-5793) 2013 Reaper homologue IBM1 in silkworm Bombyx mori induces apoptosis upon baculovirus infection. Reaper homologue IBM1 in silkworm Bombyx mori induces apoptosis upon baculovirus infection. FEBS Lett. (0014-5793) 2013 Wu Y., Wu Y., Hui T., Wu H., Wu Y., Wang W. bommo-bmn Bombyx mori bmn bmn anti tag coip anti tag coimmunoprecipitation anti tag coip experimental particp experimental participant identification experimental particp Wu Y., Wu Y., Hui T., Wu H., Wu Y., Wang W. FEBS Lett. (0014-5793) 2013 o92435_npvbm iap2 iap-2 Bm(Br)Orf-62 Bmnpvguangxigp060 bmnpvC6gp057 bmnpvc1gp057 bmnpvc2gp057 protein protein bmnpv Bombyx mori nuclear polyhedrosis virus MNLRQFNFLILSTDGRFRTMANMSLDNEYKFELAKTGLFSHNNLIKCIGCRTILDKINAKQIKRHTYSDYCISSTNALMFNEPMRKKSFTSFKKSRRQFASQSVVVDMLARRGFYYFGKAGHLRCSGCHIVFKYKSVDDAQRRHKQNCKFVNAIEDYSVNEHFSKLDVAEKEILAADLSPPQLSVKPSAPPAEPLTQHVSECKVCFDREKSVCFMPCRHLAVCTECSRRCKRCCVCNAKIMQRIETLPQ mint F26430CE383CD87D ibm1 Ibm1 protein protein bommo Bombyx mori Silk moth MAIAFNLPSEREAADENFSRLNRLLAELYEVLCHILVSRQPGEVQENRRGECPRAPSPPPYHLRCNSTYIVNLVMVVAIIKVSLASSLFNTIR mint iap2-ibm1 1 Ibm1 4 tag fluorescence tag visualisation by fluorescence tag fluorescence experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell rfp tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined IAP2 3 tag fluorescence tag visualisation by fluorescence tag fluorescence experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization f4a mint Co-localisation analysis performed at 48 h p.i. in BmN cells, comparing the localisation of IBM1-RFP with IAP2-GFP, revealed that IBM1 could interact with BmNPV IAP2 (Fig 4A). ibm1-iap2 2 Ibm1 4 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell rfp tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined IAP2 3 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4b mint iap2-ibm1-1 2 IAP2 3 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Ibm1 4 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell rfp tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4b mint