IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. Cell (0092-8674) 2013 imex curation Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. kimyo@rockefeller.edu,greengard@rockefeller.edu 28-Oct_2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain-hippocampus Mus musculus brain_hippocampus brain hippocampus anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. kimyo@rockefeller.edu,greengard@rockefeller.edu Accepted 2013-OCT-15 by MGT 28-Oct_2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. Cell (0092-8674) 2013 imex curation Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. kimyo@rockefeller.edu,greengard@rockefeller.edu 28-Oct_2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. Crystal 4hrh contains a fusion protein so I have not curated this. kimyo@rockefeller.edu,greengard@rockefeller.edu Accepted 2013-OCT-15 by MGT 28-Oct_2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. Cell (0092-8674) 2013 imex curation Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. kimyo@rockefeller.edu,greengard@rockefeller.edu 28-Oct_2013: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. At least one of the mutants appears to have minimal difference on some of the interacting proteins, but the text makes a blanket statement that all interactions are decreased so I've left it as such. Additional detail on the constructs obtained from the authors kimyo@rockefeller.edu,greengard@rockefeller.edu Accepted 2013-OCT-15 by MGT 28-Oct_2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. Cell (0092-8674) 2013 imex curation Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. kimyo@rockefeller.edu,greengard@rockefeller.edu 28-Oct_2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. Additional detail on constructs obtained from the authors. kimyo@rockefeller.edu,greengard@rockefeller.edu Accepted 2013-OCT-15 by MGT 28-Oct_2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. Cell (0092-8674) 2013 imex curation Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. kimyo@rockefeller.edu,greengard@rockefeller.edu 28-Oct_2013: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. Additional detail on the constructs obtained from the authors kimyo@rockefeller.edu,greengard@rockefeller.edu Accepted 2013-OCT-15 by MGT 28-Oct_2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. Cell (0092-8674) 2013 imex curation Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. kimyo@rockefeller.edu,greengard@rockefeller.edu 28-Oct_2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-n2a Mouse neuroblastoma cells n2a Murine neuroblastoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. kimyo@rockefeller.edu,greengard@rockefeller.edu Accepted 2013-OCT-15 by MGT 28-Oct_2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. Cell (0092-8674) 2013 imex curation Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. kimyo@rockefeller.edu,greengard@rockefeller.edu 28-Oct_2013: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. Additional detail on the constructs obtained from the authors kimyo@rockefeller.edu,greengard@rockefeller.edu Accepted 2013-OCT-15 by MGT 28-Oct_2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. Cell (0092-8674) 2013 imex curation Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. kimyo@rockefeller.edu,greengard@rockefeller.edu 28-Oct_2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. kimyo@rockefeller.edu,greengard@rockefeller.edu Accepted 2013-OCT-15 by MGT 28-Oct_2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. Cell (0092-8674) 2013 imex curation Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. kimyo@rockefeller.edu,greengard@rockefeller.edu 28-Oct_2013: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. kimyo@rockefeller.edu,greengard@rockefeller.edu Accepted 2013-OCT-15 by MGT 28-Oct_2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action. Cell (0092-8674) 2013 imex curation Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. kimyo@rockefeller.edu,greengard@rockefeller.edu 28-Oct_2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Oh Y.S., Gao P., Lee K.W., Ceglia I., Seo J.S., Zhang X., Ahn J.H., Chait B.T., Patel D.J., Kim Y., Greengard P. Additional detail on the constructs obtained from the authors kimyo@rockefeller.edu,greengard@rockefeller.edu Accepted 2013-OCT-15 by MGT 28-Oct_2013: Contacted by IntAct-Help. Cell (0092-8674) 2013 Only protein-protein interactions imex curation s10aa_human Protein S100-A10 S100 calcium-binding protein A10 Calpactin-1 light chain Calpactin I light chain p10 protein p11 Cellular ligand of annexin II S100A10 ANX2LG CAL1L CLP11 protein protein human Homo sapiens Human MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK 3E8E03A6E7DD7A8D s10aa_chlae_protein Protein S100-A10 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey Similar to P62504 ahnk_human Neuroblast differentiation-associated protein AHNAK PM227 Desmoyokin AHNAK protein protein human Homo sapiens Human MEKEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGATIYFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTWTREVFSSCSSEVVLSGDDEEYQRIYTTKIKPRLKSEDGVEGDLGETQSRTITVTRRVTAYTVDVTGREGAKDIDISSPEFKIKIPRHELTEISNVDVETQSGKTVIRLPSGSGAASPTGSAVDIRAGAISASGPELQGAGHSKLQVTMPGIKVGGSGVNVNAKGLDLGGRGGVQVPAVDISSSLGGRAVEVQGPSLESGDHGKIKFPTMKVPKFGVSTGREGQTPKAGLRVSAPEVSVGHKGGKPGLTIQAPQLEVSVPSANIEGLEGKLKGPQITGPSLEGDLGLKGAKPQGHIGVDASAPQIGGSITGPSVEVQAPDIDVQGPGSKLNVPKMKVPKFSVSGAKGEETGIDVTLPTGEVTVPGVSGDVSLPEIATGGLEGKMKGTKVKTPEMIIQKPKISMQDVDLSLGSPKLKGDIKVSAPGVQGDVKGPQVALKGSRVDIETPNLEGTLTGPRLGSPSGKTGTCRISMSEVDLNVAAPKVKGGVDVTLPRVEGKVKVPEVDVRGPKVDVSAPDVEAHGPEWNLKMPKMKMPTFSTPGAKGEGPDVHMTLPKGDISISGPKVNVEAPDVNLEGLGGKLKGPDVKLPDMSVKTPKISMPDVDLHVKGTKVKGEYDVTVPKLEGELKGPKVDIDAPDVDVHGPDWHLKMPKMKMPKFSVPGFKAEGPEVDVNLPKADVDISGPKIDVTAPDVSIEEPEGKLKGPKFKMPEMNIKVPKISMPDVDLHLKGPNVKGEYDVTMPKVESEIKVPDVELKSAKMDIDVPDVEVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVDISGPKVGVEVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDVDLHMKGPKVKGEYDMTVPKLEGDLKGPKVDVSAPDVEMQGPDWNLKMPKIKMPKFSMPSLKGEGPEFDVNLSKANVDISAPKVDTNAPDLSLEGPEGKLKGPKFKMPEMHFRAPKMSLPDVDLDLKGPKMKGNVDISAPKIEGEMQVPDVDIRGPKVDIKAPDVEGQGLDWSLKIPKMKMPKFSMPSLKGEGPEVDVNLPKADVVVSGPKVDIEAPDVSLEGPEGKLKGPKFKMPEMHFKTPKISMPDVDLHLKGPKVKGDVDVSVPKVEGEMKVPDVEIKGPKMDIDAPDVEVQGPDWHLKMPKMKMPKFSMPGFKGEGREVDVNLPKADIDVSGPKVDVEVPDVSLEGPEGKLKGPKFKMPEMHFKAPKISMPDVDLNLKGPKLKGDVDVSLPEVEGEMKVPDVDIKGPKVDISAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVKLPKADVDVSGPKMDAEVPDVNIEGPDAKLKGPKFKMPEMSIKPQKISIPDVGLHLKGPKMKGDYDVTVPKVEGEIKAPDVDIKGPKVDINAPDVEVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDMNLPKADLGVSGPKVDIDVPDVNLEAPEGKLKGPKFKMPSMNIQTHKISMPDVGLNLKAPKLKTDVDVSLPKVEGDLKGPEIDVKAPKMDVNVGDIDIEGPEGKLKGPKFKMPEMHFKAPKISMPDVDLHLKGPKVKGDMDVSVPKVEGEMKVPDVDIKGPKVDIDAPDVEVHDPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADIDVSGPSVDTDAPDLDIEGPEGKLKGSKFKMPKLNIKAPKVSMPDVDLNLKGPKLKGEIDASVPELEGDLRGPQVDVKGPFVEAEVPDVDLECPDAKLKGPKFKMPEMHFKAPKISMPDVDLHLKGPKVKGDADVSVPKLEGDLTGPSVGVEVPDVELECPDAKLKGPKFKMPDMHFKAPKISMPDVDLHLKGPKVKGDVDVSVPKLEGDLTGPSVGVEVPDVELECPDAKLKGPKFKMPEMHFKTPKISMPDVDLHLKGPKVKGDMDVSVPKVEGEMKVPDVDIKGPKMDIDAPDVDVHGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVVVSGPKVDVEVPDVSLEGPEGKLKGPKLKMPEMHFKAPKISMPDVDLHLKGPKVKGDVDVSLPKLEGDLTGPSVDVEVPDVELECPDAKLKGPKFKMPEMHFKTPKISMPDVNLNLKGPKVKGDMDVSVPKVEGEMKVPDVDIRGPKVDIDAPDVDVHGPDWHLKMPKMKMPKFSMPGFKGEGPEVDVNLPKADVDVSGPKVDVEVPDVSLEGPEGKLKGPKFKMPEMHFKTPKISMPDVDFNLKGPKIKGDVDVSAPKLEGELKGPELDVKGPKLDADMPEVAVEGPNGKWKTPKFKMPDMHFKAPKISMPDLDLHLKSPKAKGEVDVDVPKLEGDLKGPHVDVSGPDIDIEGPEGKLKGPKFKMPDMHFKAPNISMPDVDLNLKGPKIKGDVDVSVPEVEGKLEVPDMNIRGPKVDVNAPDVQAPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVDISGPKVDIEGPDVNIEGPEGKLKGPKLKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDINAPDVGVQGPDWHLKMPKVKMPKFSMPGFKGEGPDGDVKLPKADIDVSGPKVDIEGPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKIKMPKISMPGFKGEGPDVDVNLPKADIDVSGPKVDVECPDVNIEGPEGKWKSPKFKMPEMHFKTPKISMPDIDLNLTGPKIKGDVDVTGPKVEGDLKGPEVDLKGPKVDIDVPDVNVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVDVSGPKVDVEGPDVNIEGPEGKLKGPKFKMPEMNIKAPKIPMPDFDLHLKGPKVKGDVDISLPKVEGDLKGPEVDIRGPQVDIDVPDVGVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADLDVSGPKVDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLPKVEGDMKVPDVDIKGPKVDINAPDVDVQGPDWHLKMPKIKMPKISMPGFKGEGPEVDVNLPKADLDVSGPKVDVDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDLDLNLKGPKMKGEVDVSLANVEGDLKGPALDIKGPKIDVDAPDIDIHGPDAKLKGPKLKMPDMHVNMPKISMPEIDLNLKGSKLKGDVDVSGPKLEGDIKAPSLDIKGPEVDVSGPKLNIEGKSKKSRFKLPKFNFSGSKVQTPEVDVKGKKPDIDITGPKVDINAPDVEVQGKVKGSKFKMPFLSISSPKVSMPDVELNLKSPKVKGDLDIAGPNLEGDFKGPKVDIKAPEVNLNAPDVDVHGPDWNLKMPKMKMPKFSVSGLKAEGPDVAVDLPKGDINIEGPSMNIEGPDLNVEGPEGGLKGPKFKMPDMNIKAPKISMPDIDLNLKGPKVKGDVDISLPKLEGDLKGPEVDIKGPKVDINAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVTLPKADIDISGPNVDVDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDFDLNLKGPKMKGDVVVSLPKVEGDLKGPEVDIKGPKVDIDTPDINIEGSEGKFKGPKFKIPEMHLKAPKISMPDIDLNLKGPKVKGDVDVSLPKMEGDLKGPEVDIKGPKVDINAPDVDVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADLDVSGPKVDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLPKVEGDMQVPDLDIKGPKVDINAPDVDVRGPDWHLKMPKIKMPKISMPGFKGEGPEVDVNLPKADLDVSGPKVDVDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKMEGDLKAPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNLPKADIDVSGPKVDIDTPDIDIHGPEGKLKGPKFKMPDLHLKAPKISMPEVDLNLKGPKMKGDVDVSLPKVEGDLKGPEVDIKGPKVDIDVPDVDVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADLDVSGPKVDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVTLPKADIEISGPKVDIDAPDVSIEGPDAKLKGPKFKMPEMNIKAPKISMPDIDFNLKGPKVKGDVDVSLPKVEGDLKGPEIDIKGPSLDIDTPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVESDLKGPEVDIEGPEGKLKGPKFKMPDVHFKSPQISMSDIDLNLKGPKIKGDMDISVPKLEGDLKGPKVDVKGPKVGIDTPDIDIHGPEGKLKGPKFKMPDLHLKAPKISMPEVDLNLKGPKVKGDMDISLPKVEGDLKGPEVDIRDPKVDIDVPDVDVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADIDVSGPKVDVDVPDVNIEGPDAKLKGPKFKMPEMSIKAPKISMPDIDLNLKGPKVKGDVDVTLPKVEGDLKGPEADIKGPKVDINTPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVSLPKADIDVSGPKVDVDIPDVNIEGPDAKLKGPKFKMPEINIKAPKISIPDVDLDLKGPKVKGDFDVSVPKVEGTLKGPEVDLKGPRLDFEGPDAKLSGPSLKMPSLEISAPKVTAPDVDLHLKAPKIGFSGPKLEGGEVDLKGPKVEAPSLDVHMDSPDINIEGPDVKIPKFKKPKFGFGAKSPKADIKSPSLDVTVPEAELNLETPEISVGGKGKKSKFKMPKIHMSGPKIKAKKQGFDLNVPGGEIDASLKAPDVDVNIAGPDAALKVDVKSPKTKKTMFGKMYFPDVEFDIKSPKFKAEAPLPSPKLEGELQAPDLELSLPAIHVEGLDIKAKAPKVKMPDVDISVPKIEGDLKGPKVQANLGAPDINIEGLDAKVKTPSFGISAPQVSIPDVNVNLKGPKIKGDVPSVGLEGPDVDLQGPEAKIKFPKFSMPKIGIPGVKMEGGGAEVHAQLPSLEGDLRGPDVKLEGPDVSLKGPGVDLPSVNLSMPKVSGPDLDLNLKGPSLKGDLDASVPSMKVHAPGLNLSGVGGKMQVGGDGVKVPGIDATTKLNVGAPDVTLRGPSLQGDLAVSGDIKCPKVSVGAPDLSLEASEGSIKLPKMKLPQFGISTPGSDLHVNAKGPQVSGELKGPGVDVNLKGPRISAPNVDFNLEGPKVKGSLGATGEIKGPTVGGGLPGIGVQGLEGNLQMPGIKSSGCDVNLPGVNVKLPTGQISGPEIKGGLKGSEVGFHGAAPDISVKGPAFNMASPESDFGINLKGPKIKGGADVSGGVSAPDISLGEGHLSVKGSGGEWKGPQVSSALNLDTSKFAGGLHFSGPKVEGGVKGGQIGLQAPGLSVSGPQGHLESGSGKVTFPKMKIPKFTFSGRELVGREMGVDVHFPKAEASIQAGAGDGEWEESEVKLKKSKIKMPKFNFSKPKGKGGVTGSPEASISGSKGDLKSSKASLGSLEGEAEAEASSPKGKFSLFKSKKPRHRSNSFSDEREFSGPSTPTGTLEFEGGEVSLEGGKVKGKHGKLKFGTFGGLGSKSKGHYEVTGSDDETGKLQGSGVSLASKKSRLSSSSSNDSGNKVGIQLPEVELSVSTKKE A82FC9645FDCA8DC b-box_pai1_3-5prime mouse tandem B-box PAI-1 promoter: 3-5prime ss dna single stranded deoxyribonucleic acid ss DNA ss dna mouse Mus musculus Mouse CATGTTCCAGCCCCACCCACTTTCTAACATGTTCCAGCCCCACCCACTTTCTAA s10aa_mouse Protein S100-A10 S100 calcium-binding protein A10 Calpactin-1 light chain Calpactin I light chain p10 protein p11 Cellular ligand of annexin II S100a10 Cal1l protein protein mouse Mus musculus Mouse MPSQMEHAMETMMLTFHRFAGDKDHLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFLSLVAGLTIACNDYFVVNMKQKGKK E7F092D4DAF6B43E hltf_mouse Helicase-like transcription factor Hltf Smarca3 Snf2l3 Zbu1 P113 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3 Sucrose nonfermenting protein 2-like 3 TNF-response element-binding protein RING-type E3 ubiquitin transferase HLTF protein protein mouse Mus musculus Mouse MSYTFTRGPVWKYSQSVQYGSHENIPRLSYSTFLPHFEFQDIIPPDDFLTSDEEQDLVLFGTMRGQVVGLRYYTGVVNNNEMVALQREPNNPYDKNAIKVNNVNGNQVGHIKREIAAAVAYIMDNKLAQVEGVVPFGASNTFTMPLYMTFWGKEENRNVVLEQLKKHGFKLGPTPKTLGSSLENAWGSGRAGPSYSRPAHVAVQMTTDQLKTEFDKLFEDLKEDDRTVEMEPAEAIETPLLPHQKQALAWMIARENSKELPPFWEQRNDLYYNTITNFSVKERPENVHGGILADDMGLGKTLTAIAVILTNFDDGRPLLSKRGKKNHPGKEYKDETIKRRGSNMDKKEDGHSESSTCGEEPSISGTPEKSSCTLSQLSSVCPKRRKISVQYIESSDSEEIETSELPQKMKGKLKNVQLNTKSRVKGSSKVKEDSKFALTFFASATQRKMLKKGMSMMECSEACDTGERTRATLIICPLSVLSNWIDQFGQHVKSEVHLNFYVYYGPDRIRDSAWLSKQDIILTTYNILTHDYGTKDDSPLHSIKWLRVILDEGHAIRNPNAQQTKAVLELEAERRWVLTGTPIQNSLKDLWSLLSFLKLKPFIDREWWYRIIQRPVTTGDEGGLRRLQSLIKNITLRRTKTSKIKGKPVLELPERKVFIQHITLSEEERKIYQSVKNEGKAAIGRYFTEGTVLAHYADVLGLLLRLRQICCHTHLLTNGMSSSGPSRSDTPEELRKMLIEKMKIILSSGSDEECAICLDSLTFPVITHCAHVFCKPCICQVIHSEQPHAKCPLCRNEIHGDNLLECPPEELACDSDKESSMEWKSSSKINALMHALIELRTKDPNIKSLVVSQFTTFLSLIETPLKASGFVFTRLDGSMAQKKRVESIQRFQNTEAGSPTIMLLSLKAGGVGLNLCAASRVFLMDPAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNTKRDLAAGAFGTKKTDANDMKQAKINEIRTLIDL 91F08509ACEA5513 hltf_human Helicase-like transcription factor SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3 Sucrose nonfermenting protein 2-like 3 DNA-binding protein/plasminogen activator inhibitor 1 regulator HIP116 RING finger protein 80 HLTF HIP116A RNF80 SNF2L3 ZBU1 SMARCA3 RING-type E3 ubiquitin transferase HLTF protein protein human Homo sapiens Human MSWMFKRDPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFSEKDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKEYNVNDDSMKLGGNNTSEKADGLSKDASRCSEQPSISDIKEKSKFRMSELSSSRPKRRKTAVQYIESSDSEEIETSELPQKMKGKLKNVQSETKGRAKAGSSKVIEDVAFACALTSSVPTTKKKMLKKGACAVEGSKKTDVEERPRTTLIICPLSVLSNWIDQFGQHIKSDVHLNFYVYYGPDRIREPALLSKQDIVLTTYNILTHDYGTKGDSPLHSIRWLRVILDEGHAIRNPNAQQTKAVLDLESERRWVLTGTPIQNSLKDLWSLLSFLKLKPFIDREWWHRTIQRPVTMGDEGGLRRLQSLIKNITLRRTKTSKIKGKPVLELPERKVFIQHITLSDEERKIYQSVKNEGRATIGRYFNEGTVLAHYADVLGLLLRLRQICCHTYLLTNAVSSNGPSGNDTPEELRKKLIRKMKLILSSGSDEECAICLDSLTVPVITHCAHVFCKPCICQVIQNEQPHAKCPLCRNDIHEDNLLECPPEELARDSEKKSDMEWTSSSKINALMHALTDLRKKNPNIKSLVVSQFTTFLSLIEIPLKASGFVFTRLDGSMAQKKRVESIQCFQNTEAGSPTIMLLSLKAGGVGLNLSAASRVFLMDPAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL DIP protein Q14527 original sequence version: 67 DIP protein Q14527 original sequence version: 69 0AB96F6C8484FD15 anxa2_human Annexin A2 ANXA2 ANX2 ANX2L4 CAL1H LPC2D Annexin-2 Annexin II Lipocortin II Calpactin I heavy chain Chromobindin-8 p36 Protein I Placental anticoagulant protein IV Calpactin-1 heavy chain protein protein human Homo sapiens Human MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD 5126E1337A0CBEA1 anxa2_chlae_protein Annexin A2 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey similar to P07355 anxa2_mouse Annexin A2 Anxa2 Anx2 Cal1h Annexin-2 Annexin II Lipocortin II Calpactin I heavy chain Chromobindin-8 p36 Protein I Placental anticoagulant protein IV Calpactin-1 heavy chain protein protein mouse Mus musculus Mouse MSTVHEILCKLSLEGDHSTPPSAYGSVKPYTNFDAERDALNIETAVKTKGVDEVTIVNILTNRSNVQRQDIAFAYQRRTKKELPSALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARELYDAGVKRKGTDVPKWISIMTERSVCHLQKVFERYKSYSPYDMLESIKKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD 4407E572097FB2C0 spt6h_human Transcription elongation factor SPT6 SUPT6H KIAA0162 SPT6H Tat-cotransactivator 2 protein Histone chaperone suppressor of Ty6 protein protein human Homo sapiens Human MSDFVESEAEESEEEYNDEGEVVPRVTKKFVEEEDDDEEEEEENLDDQDEQGNLKGFINDDDDEDEGEEDEGSDSGDSEDDVGHKKRKRTSFDDRLEDDDFDLIEENLGVKVKRGQKYRRVKKMSDDEDDDEEEYGKEEHEKEAIAEEIFQDGEGEEGQEAMEAPMAPPEEEEEDDEESDIDDFIVDDDGQPLKKPKWRKKLPGYTDAALQEAQEIFGVDFDYDEFEKYNEYDEELEEEYEYEDDEAEGEIRVRPKKTTKKRVSRRSIFEMYEPSELESSHLTDQDNEIRATDLPERFQLRSIPVKGAEDDELEEEADWIYRNAFATPTISLQESCDYLDRGQPASSFSRKGPSTIQKIKEALGFMRNQHFEVPFIAFYRKEYVEPELHINDLWRVWQWDEKWTQLRIRKENLTRLFEKMQAYQYEQISADPDKPLADGIRALDTTDMERLKDVQSMDELKDVYNHFLLYYGRDIPKMQNAAKASRKKLKRVREEGDEEGEGDEAEDEEQRGPELKQASRRDMYTICQSAGLDGLAKKFGLTPEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFPTPEAVLEGARYMVALQIAREPLVRQVLRQTFQERAKLNITPTKKGRKDVDEAHYAYSFKYLKNKPVKELRDDQFLKICLAEDEGLLTTDISIDLKGVEGYGNDQTYFEEIKQFYYRDEFSHQVQEWNRQRTMAIERALQQFLYVQMAKELKNKLLAEAKEYVIKACSRKLYNWLRVAPYRPDQQVEEDDDFMDENQGKGIRVLGIAFSSARDHPVFCALVNGEGEVTDFLRLPHFTKRRTAWREEEREKKAQDIETLKKFLLNKKPHVVTVAGENRDAQMLIEDVKRIVHELDQGQQLSSIGVELVDNELAILYMNSKKSEAEFRDYPPVLRQAVSLARRIQDPLIEFAQVCSSDEDILCLKFHPLQEHVVKEELLNALYCEFINRVNEVGVDVNRAIAHPYSQALIQYVCGLGPRKGTHLLKILKQNNTRLESRTQLVTMCHMGPKVFMNCAGFLKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGDKHITLYDIRAELSCRYKDLRTAYRSPNTEEIFNMLTKETPETFYIGKLIICNVTGIAHRRPQGESYDQAIRNDETGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVKTRLDNGVTGFIPTKFLSDKVVKRPEERVKVGMTVHCRIMKIDIEKFSADLTCRTSDLMDRNNEWKLPKDTYYDFDAEAADHKQEEDMKRKQQRTTYIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVSDGIYQHVDVREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPMASFARDLLNHKYYQDCSGGDRKKLEELLIKTKKEKPTFIPYFICACKELPGKFLLGYQPRGKPRIEYVTVTPEGFRYRGQIFPTVNGLFRWFKDHYQDPVPGITPSSSSRTRTPASINATPANINLADLTRAVNALPQNMTSQMFSAIAAVTGQGQNPNATPAQWASSQYGYGGSGGGSSAYHVFPTPAQQPVATPLMTPSYSYTTPSQPITTPQYHQLQASTTPQSAQAQPQPSSSSRQRQQQPKSNSHAAIDWGKMAEQWLQEKEAERRKQKQRLTPRPSPSPMIESTPMSIAGDATPLLDEMDR F7EB22FA669EB030 hltf_chlae_protein Helicase-like transcription factor (SMARCA3) protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey Similar to Q14527 s10aa_rat Protein S100-A10 S100a10 S100 calcium-binding protein A10 Calpactin-1 light chain Calpactin I light chain p10 protein p11 Cellular ligand of annexin II Nerve growth factor-induced protein 42C protein protein rat Rattus norvegicus (Rat) Rat MPSQMEHAMETMMLTFHRFAGEKNYLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFLSLVAGLIIACNDYFVVHMKQKK EC12960C177F1BBC s100a10-anxa2 6 15 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association Fig. 1C s100a10-anxa2-1 1 15 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association Fig. 1C s100a10-anxa2-2 7 23 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association Supp. Fig. 1A Cys83Ser and Cys83Gln mutations in p11 significantly decreased the interaction with AnxA2, without altering the interaction with endogenous p11 to form a p11 dimer. s100a10-s100a10-1 7 23 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P05943:p.Cys83Gln mutation mutation certain certain sequence position certain certain certain sequence position certain C Q Wed May 02 17:29:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys83gln' Tue Jun 30 17:49:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys83Gln' P05943:p.Cys83Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 14:53:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys83ser' Tue Jun 30 16:26:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys83Ser' 12 unspecified role unspecified role prey prey physical association physical association Supp. Fig. 1A Cys83Ser and Cys83Gln mutations in p11 significantly decreased the interaction with AnxA2, without altering the interaction with endogenous p11 to form a p11 dimer. s100a10-s100a10-2 5 23 unspecified role unspecified role bait bait P05943:p.Cys83Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 19:41:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys83ser' Tue Jun 30 19:27:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys83Ser' P05943:p.Cys83Gln mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C Q Wed May 02 16:36:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys83gln' Tue Jun 30 16:07:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys83Gln' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey association association Fig. 2A Cys83Ser and Cys83Gln mutations in p11 significantly decreased the interaction with AnxA2, without altering the interaction with endogenous p11 to form a p11 dimer. s100a10-s10aa-1 3 23 unspecified role unspecified role bait bait P05943:p.Cys83Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 19:25:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys83ser' Tue Jun 30 19:05:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys83Ser' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P05943:p.Cys83Gln mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C Q Wed May 02 16:23:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys83gln' Tue Jun 30 18:21:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys83Gln' 13 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey association association Fig. 2B Cys83Ser and Cys83Gln mutations in p11 significantly decreased the interaction with AnxA2, without altering the interaction with endogenous p11 to form a p11 dimer. s100a10-hltf 4 17 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role bait bait P60903:p.Cys83Gln mutation mutation certain certain sequence position certain certain certain sequence position certain C Q Wed May 02 15:31:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys83gln' Tue Jun 30 18:05:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys83Gln' P60903:p.Cys83Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 20:04:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys83ser' Tue Jun 30 17:48:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys83Ser' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig. 2D, Supp. Fig. 1B, 1C, 1D The s100a10-SMARCA3 interaction was significantly increased by the addition of AnxA2 to the pull-down assay mixture s100a10-hltf 4 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Fig. 2D The s100a10-SMARCA3 interaction was significantly increased by the addition of AnxA2 to the pull-down assay mixture hltf-anxa2 8 16 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey physical association physical association Fig. 2C ahnak-anxa2-1 10 15 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) association association Fig. 2F hltf-anxa2-6 10 15 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) association association Fig. 2F ahnak-s100a10 2 13 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 11 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 93 95 direct interaction direct interaction Supp. Table 1 Rwork = 0.19 Rfree = 0.22 2A hltf-anxa2-5 7 12 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait Q14527:p.Phe37Tyr mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F Y Wed May 02 20:10:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe37tyr' Tue Jun 30 16:12:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe37Tyr' Q14527:p.Pro35Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P A Wed May 02 15:08:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro35ala' Tue Jun 30 20:07:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro35Ala' c-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Supp. Fig. 3A anxa2-hltf-2 7 12 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait P07356:p.Leu8Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L A Wed May 02 14:57:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu8ala' Tue Jun 30 18:27:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu8Ala' P07356:p.Leu11Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L A Wed May 02 20:13:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu11ala' Tue Jun 30 18:15:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu11Ala' c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Supp. Fig. 3B anxa2-s100a10 7 12 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait P07356:p.Leu13Ala mutation mutation certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:22:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu13ala' Tue Jun 30 20:07:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu13Ala' c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Supp. Fig. 3B s100a10-anxa2-3 7 23 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association Supp. Fig. 3C s100a10-anxa2-4 7 23 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P05943:p.Asp60Ala mutation mutation certain certain sequence position certain certain certain sequence position certain D A Wed May 02 15:02:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp60ala' Tue Jun 30 17:10:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp60Ala' 19 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association Supp. Fig. 3C b_box-anxa2-2 10 15 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) association association Fig. 4A b_box-b_box 10 14 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 17 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. 4A hltf-s100a10 9 22 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 4C hltf-anxa2-3 1 15 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association Fig. 6F Fluoxetine (a selective serotonin re-uptake inhibitor) for 2 weeks