IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ RAB7L1 Interacts with LRRK2 to Modify Intraneuronal Protein Sorting and Parkinson's Disease Risk. RAB7L1 Interacts with LRRK2 to Modify Intraneuronal Protein Sorting and Parkinson's Disease Risk. Neuron (0896-6273) 2013 imex curation Macleod D.A., Rhinn H., Kuwahara T., Zolin A., Di Paolo G., Maccabe B.D., Marder K.S., Honig L.S., Clark L.N., Small S.A., Abeliovich A. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease the RABL1 REPORTER minigene is human and contains "first exon, the first intron and the second exon and 200 bp of the second intron" (from M+M) - so this might be aas 1-..65? - which is not the same as the "AT" construct -which is not mentioned in the M+M. (is lacking exon 2 and 3 so would be aas ~65-203 according to fig S5C). The species of the "AT" RABL1 construct and amino acid numbering, as well as origin of GFP-VPS35 (Fig 7E) is not known. The authors have not responded to requests for clarification, so no interactions with these constructs have been included. aa900@columbia.edu 27-Mar-2013: Contacted by IntAct-Help. Only protein-protein interactions human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Macleod D.A., Rhinn H., Kuwahara T., Zolin A., Di Paolo G., Maccabe B.D., Marder K.S., Honig L.S., Clark L.N., Small S.A., Abeliovich A. Parkinsons - Interactions investigated in the context of Parkinsons disease the RABL1 REPORTER minigene is human and contains "first exon, the first intron and the second exon and 200 bp of the second intron" (from M+M) - so this might be aas 1-..65? - which is not the same as the "AT" construct -which is not mentioned in the M+M. (is lacking exon 2 and 3 so would be aas ~65-203 according to fig S5C). The species of the "AT" RABL1 construct and amino acid numbering, as well as origin of GFP-VPS35 (Fig 7E) is not known. The authors have not responded to requests for clarification, so no interactions with these constructs have been included. aa900@columbia.edu Accepted 2013-MAR-22 by ORCHARD 27-Mar-2013: Contacted by IntAct-Help. Neuron (0896-6273) 2013 Only protein-protein interactions imex curation RAB7L1 Interacts with LRRK2 to Modify Intraneuronal Protein Sorting and Parkinson's Disease Risk. RAB7L1 Interacts with LRRK2 to Modify Intraneuronal Protein Sorting and Parkinson's Disease Risk. Neuron (0896-6273) 2013 imex curation Macleod D.A., Rhinn H., Kuwahara T., Zolin A., Di Paolo G., Maccabe B.D., Marder K.S., Honig L.S., Clark L.N., Small S.A., Abeliovich A. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease the RABL1 REPORTER minigene is human and contains "first exon, the first intron and the second exon and 200 bp of the second intron" (from M+M) - so this might be aas 1-..65? - which is not the same as the "AT" construct -which is not mentioned in the M+M. (is lacking exon 2 and 3 so would be aas ~65-203 according to fig S5C). The species of the "AT" RABL1 construct and amino acid numbering, as well as origin of GFP-VPS35 (Fig 7E) is not known. The authors have not responded to requests for clarification, so no interactions with these constructs have been included. aa900@columbia.edu 27-Mar-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Macleod D.A., Rhinn H., Kuwahara T., Zolin A., Di Paolo G., Maccabe B.D., Marder K.S., Honig L.S., Clark L.N., Small S.A., Abeliovich A. Parkinsons - Interactions investigated in the context of Parkinsons disease the RABL1 REPORTER minigene is human and contains "first exon, the first intron and the second exon and 200 bp of the second intron" (from M+M) - so this might be aas 1-..65? - which is not the same as the "AT" construct -which is not mentioned in the M+M. (is lacking exon 2 and 3 so would be aas ~65-203 according to fig S5C). The species of the "AT" RABL1 construct and amino acid numbering, as well as origin of GFP-VPS35 (Fig 7E) is not known. The authors have not responded to requests for clarification, so no interactions with these constructs have been included. aa900@columbia.edu Accepted 2013-MAR-22 by ORCHARD 27-Mar-2013: Contacted by IntAct-Help. Neuron (0896-6273) 2013 Only protein-protein interactions imex curation RAB7L1 Interacts with LRRK2 to Modify Intraneuronal Protein Sorting and Parkinson's Disease Risk. RAB7L1 Interacts with LRRK2 to Modify Intraneuronal Protein Sorting and Parkinson's Disease Risk. Neuron (0896-6273) 2013 imex curation Macleod D.A., Rhinn H., Kuwahara T., Zolin A., Di Paolo G., Maccabe B.D., Marder K.S., Honig L.S., Clark L.N., Small S.A., Abeliovich A. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease the RABL1 REPORTER minigene is human and contains "first exon, the first intron and the second exon and 200 bp of the second intron" (from M+M) - so this might be aas 1-..65? - which is not the same as the "AT" construct -which is not mentioned in the M+M. (is lacking exon 2 and 3 so would be aas ~65-203 according to fig S5C). The species of the "AT" RABL1 construct and amino acid numbering, as well as origin of GFP-VPS35 (Fig 7E) is not known. The authors have not responded to requests for clarification, so no interactions with these constructs have been included. aa900@columbia.edu 27-Mar-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Macleod D.A., Rhinn H., Kuwahara T., Zolin A., Di Paolo G., Maccabe B.D., Marder K.S., Honig L.S., Clark L.N., Small S.A., Abeliovich A. Parkinsons - Interactions investigated in the context of Parkinsons disease the RABL1 REPORTER minigene is human and contains "first exon, the first intron and the second exon and 200 bp of the second intron" (from M+M) - so this might be aas 1-..65? - which is not the same as the "AT" construct -which is not mentioned in the M+M. (is lacking exon 2 and 3 so would be aas ~65-203 according to fig S5C). The species of the "AT" RABL1 construct and amino acid numbering, as well as origin of GFP-VPS35 (Fig 7E) is not known. The authors have not responded to requests for clarification, so no interactions with these constructs have been included. aa900@columbia.edu Accepted 2013-MAR-22 by ORCHARD 27-Mar-2013: Contacted by IntAct-Help. Neuron (0896-6273) 2013 Only protein-protein interactions imex curation RAB7L1 Interacts with LRRK2 to Modify Intraneuronal Protein Sorting and Parkinson's Disease Risk. RAB7L1 Interacts with LRRK2 to Modify Intraneuronal Protein Sorting and Parkinson's Disease Risk. Neuron (0896-6273) 2013 imex curation Macleod D.A., Rhinn H., Kuwahara T., Zolin A., Di Paolo G., Maccabe B.D., Marder K.S., Honig L.S., Clark L.N., Small S.A., Abeliovich A. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease the RABL1 REPORTER minigene is human and contains "first exon, the first intron and the second exon and 200 bp of the second intron" (from M+M) - so this might be aas 1-..65? - which is not the same as the "AT" construct -which is not mentioned in the M+M. (is lacking exon 2 and 3 so would be aas ~65-203 according to fig S5C). The species of the "AT" RABL1 construct and amino acid numbering, as well as origin of GFP-VPS35 (Fig 7E) is not known. The authors have not responded to requests for clarification, so no interactions with these constructs have been included. aa900@columbia.edu 27-Mar-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain_substantia nigra Mus musculus, brain, substantia nigra brain_substantia nigra BRAIN_SUBSTANTIA NIGRA confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Macleod D.A., Rhinn H., Kuwahara T., Zolin A., Di Paolo G., Maccabe B.D., Marder K.S., Honig L.S., Clark L.N., Small S.A., Abeliovich A. Parkinsons - Interactions investigated in the context of Parkinsons disease the RABL1 REPORTER minigene is human and contains "first exon, the first intron and the second exon and 200 bp of the second intron" (from M+M) - so this might be aas 1-..65? - which is not the same as the "AT" construct -which is not mentioned in the M+M. (is lacking exon 2 and 3 so would be aas ~65-203 according to fig S5C). The species of the "AT" RABL1 construct and amino acid numbering, as well as origin of GFP-VPS35 (Fig 7E) is not known. The authors have not responded to requests for clarification, so no interactions with these constructs have been included. aa900@columbia.edu Accepted 2013-MAR-22 by ORCHARD 27-Mar-2013: Contacted by IntAct-Help. Neuron (0896-6273) 2013 Only protein-protein interactions imex curation rab7l_rat Ras-related protein Rab-7L1 Rab29 Rab-7-like protein 1 Rab7l1 Ras-related protein Rab-29 protein protein rat Rattus norvegicus (Rat) Rat MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDSEMVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPSGEPVPCLLLANKSDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLVEKMMNNSREDIMSSSTQGNYINLQTKPSPGWTCC DIP protein Q63481 original sequence version: 84 4CFAE889718F20E5 vps35_mouse Vacuolar protein sorting-associated protein 35 Vesicle protein sorting 35 Maternal-embryonic 3 Vps35 Mem3 protein protein mouse Mus musculus Mouse MPTTQQSPQDEQEKLLDEAIQAVKVQSFQMKRCLDKNKLMDALKHASNMLGELRTSMLSPKSYYELYMAISDELHYLEVYLTDEFAKGRKVADLYELVQYAGNIIPRLYLLITVGVVYVKSFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPDEGEPTDEETTGDISDSMDFVLLNFAEMNKLWVRMQHQGHSRDREKRERERQELRILVGTNLVRLSQLEGVNVERYKQIVLTGILEQVVNCRDALAQEYLMECIIQVFPDEFHLQTLNPFLRACAELHQNVNVKNIIIALIDRLALFAHREDGPGIPAEIKLFDIFSQQVATVIQSRQDMPSEDVVSLQVSLINLAMKCYPDRVDYVDKVLETTVEIFNKLNLEHIATSSAVSKELTRLLKIPVDTYNNILTVLKLKHFHPLFEYFDYESRKSMSCYVLSNVLDYNTEIVSQDQVDSIMNLVSTLIQDQPDQPVEDPDPEDFADEQSLVGRFIHLLRSDDPDQQYLILNTARKHFGAGGNQRIRFTLPPLVFAAYQLAFRYKENSQMDDKWEKKCQKIFSFAHQTISALIKAELAELPLRLFLQGALAAGEIGFENHETVAYEFMSQAFSLYEDEISDSKAQLAAITLIIGTFERMKCFSEENHEPLRTQCALAASKLLKKPDQGRAVSTCAHLFWSGRNTDKNGEELHGGKRVMECLKKALKIANQCMDPSLQVQLFIEILNRYIYFYEKENDAVTIQVLNQLIQKIREDLPNLESSEETEQINKHFHNTLEHLRSRRESPESEGPIYEGLIL DIP protein Q9EQH3 original sequence version: 93 DIP protein Q9EQH3 original sequence version: 57 2ABD338111D641CC lrrk2_human Leucine-rich repeat serine/threonine-protein kinase 2 LRRK2 PARK8 Dardarin protein protein human Homo sapiens Human MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSERASKLFQGKNIHVPLLIVLDSYMRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILKMLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVEVLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQQYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWHRKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHREVMLSMLMHSSSKEVFQASANALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIMAAVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNRFIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQEIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSASFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQNNSIMVECLLLLGADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIGKGDSQIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLARMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEGSFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLRSSKLQSHMRHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQNALTSFPQQLCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTVKCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKISGICSPLRLKELKILNLSKNHISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRSLDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQIRDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDNHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYGCAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHHNSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRTSQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKENKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRRTSVE DIP protein Q5S007 original sequence version: 36 DIP protein Q5S007 original sequence version: 68 DIP protein Q5S007 original sequence version: 64 26142A0CECBBC3F4 lrrk2_mouse Leucine-rich repeat serine/threonine-protein kinase 2 Lrrk2 protein protein mouse Mus musculus Mouse MASGACQGCEEEEEEEALKKLIVRLNNVQEGKQIETLLQLLEDMLVFTYSDRASKLFEDKNFHVPLLIVLDSYMRVASVQQAGWSLLCKLIEVCPGTLQSLIGPQDIGNDWEVLGIHRLILKMLTVHHANVNLSIVGLKALDLLLDSGKLTLLILDEECDIFLLIFDAMHRYSANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYTILLSTFGSFRRDKEIVYHVLCCLHSLAVTCSNVEVLMSGNVRCYNLVVEAMKAFPTNENIQEVSCSLFQKLTLGNFFNILVLNEVHVFVVKAVRQYPENAALQISALSCLALLTETIFLNQDLEERSETQEQSEEEDSEKLFWLEPCYKALVRHRKDKHVQEAACWALNNLLMYQNSLHEKIGDEDGQFPAHREVMLSMLMHSSSKDVFQAAAHALSTLLEQNVNFRKILLAKGVYLNVLELMQKHAHAPEVAESGCKMLSHLFEGSNPSLDTMAAVVPKILTVMKAHGTSLSVQLEALRAILHFVVPGLLEESREDSQCRPNVLRKQCFRTDIHKLVLVALNRFIGNPGIQKCGLKVISSLAHLPDATETLSLQGAVDSVLHTLQMYPDDQEIQCLGLHLMGCLMTKKNFCIGTGHLLAKILASTLQRFKDVAEVQTTGLQTTLSILELSVSFSKLLVHYSFDVVIFHQMSSSVVEQKDEQFLNLCCKCFAKVAVDDELKNTMLERACDQNNSIMVECLLLLGADANQVKGATSLIYQVCEKESSPKLVELLLNGGCREQDVRKALTVSIQKGDSQVISLLLRKLALDLANNSICLGGFGIGKIDPSWLGPLFPDKSSNLRKQTNTGSVLARKVLRYQMRNTLQEGVASGSDGKFSEDALAKFGEWTFIPDSSMDSVFGQSDDLDSEGSESSFLVKRKSNSISVGEVYRDLALQRCSPNAQRHSNSLGPVFDHEDLLRRKRKILSSDESLRSSRLPSHMRQSDSSSSLASEREHITSLDLSANELKDIDALSQKCCLSSHLEHLTKLELHQNSLTSFPQQLCETLKCLIHLDLHSNKFTSFPSFVLKMPRITNLDASRNDIGPTVVLDPAMKCPSLKQLNLSYNQLSSIPENLAQVVEKLEQLLLEGNKISGICSPLSLKELKILNLSKNHIPSLPGDFLEACSKVESFSARMNFLAAMPALPSSITSLKLSQNSFTCIPEAIFSLPHLRSLDMSHNNIECLPGPAHWKSLNLRELIFSKNQISTLDFSENPHVWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDGLHLNFDFKHVGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKMKKPELGMQGATVGIDVRDWSIQIRGKRRKDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACISKITKELLNKRGFPTIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQPVVGQLIPDCYVELEKIILSERKAVPTEFPVINRKHLLQLVNEHQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKVMAQILTVKVDGCLKHPKGIISRRDVEKFLSKKKRFPKNYMMQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPFMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDNRPESFLKITVPSCRKGCILLGRVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDELMKKAEEGDLLINPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEEAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLHDIWTTGSRIMEGLRFPNEFDELAIQGKLPDPVKEYGCAPWPMVEKLITKCLKENPQERPTSAQVFDILNSAELICLMRHILIPKNIIVECMVATNLNSKSATLWLGCGNTEKGQLSLFDLNTERYSYEEVADSRILCLALVHLAAEKESWVVCGTQSGALLVINVEEETKRHTLEKMTDSVTCLHCNSLAKQSKQSNFLLVGTADGNLMIFEDKAVKCKGAAPLKTLHIGDVSTPLMCLSESLNSSERHITWGGCGTKVFSFSNDFTIQKLIETKTNQLFSYAAFSDSNIIALAVDTALYIAKKNSPVVEVWDKKTEKLCELIDCVHFLKEVMVKLNKESKHQLSYSGRVKALCLQKNTALWIGTGGGHILLLDLSTRRVIRTIHNFCDSVRAMATAQLGSLKNVMLVLGYKRKSTEGIQEQKEIQSCLSIWDLNLPHEVQNLEKHIEVRTELADKMRKTSVE DIP protein Q5S006 original sequence version: 57 706E25C173E36F98 rab7l_mouse Ras-related protein Rab-7L1 Rab29 Rab-7-like protein 1 Rab7l1 protein protein mouse Mus musculus Mouse MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDSEMVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPSGEPVPCLLLANKSDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLVEKMMNNSREDVMSLSTQGNYINLQAKPSSGWTCC 1D05E98967E120F3 lrrk2-rab7l1 2 7 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3A rab7l1-lrrk2 2 7 unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3B lrrk2-rab7l1-1 3 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 3C lrrk2-rab7l1-3 1 5 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q63481:p.Gln67Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 17:01:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln67leu' Tue Jun 30 16:23:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln67Leu' Q63481:p.Thr21Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T N Wed May 02 19:00:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr21asn' Tue Jun 30 17:40:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr21Asn' 7 unspecified role unspecified role neutral component neutral component n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization 3D A RAB7L1 alternative transcript (AT) mini-gene plasmid was diffusely localized through the cytoplasm and showed reduced localization to the Golgi apparatus. I would have entered the AT splice variant of RABL1 as a "required to bind" feature - but then I noticed it was possibly HUMAN - so cannot be entered w.r.t a RAT protein (durgh!...) lrrk2-rab7l1-5 3 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 7F, S6 lrrk2-rab7l1-6 4 7 unspecified role unspecified role neutral component neutral component n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role neutral component neutral component colocalization colocalization S3A lrrk2-rab7l1-7 4 9 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization S3Ai lrrk2-vps35-2 3 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 7F, S6-2 lrrk2-rab7l1-8 3 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 3C-2