MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Thymidine kinase 1 regulatory fine-tuning through tetramer formation. Thymidine kinase 1 regulatory fine-tuning through tetramer formation. FEBS J. (1742-464X) 2013 Mutahir Z., Clausen AR., Andersson KM., Wisen SM., Munch-Petersen B., Piškur J. suggested by lperfetto Zeeshan.Mutahir@biol.lu.se in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mutahir Z., Clausen AR., Andersson KM., Wisen SM., Munch-Petersen B., Piškur J. suggested by lperfetto Zeeshan.Mutahir@biol.lu.se FEBS J. (1742-464X) 2013 kithb_arath Thymidine kinase b TK1B MYJ24.6 At5g23070 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MFGVSMRTLISPSLAPFSLHLHKPSLFSTALRFSFSINNITPTNSPPSTISTRKLQTKATRVTSSSSSQPLSSSSPGEIHVVVGPMFSGKTTTLLRRILAERETGKRIAIIKSNKDTRYCTESIVTHDGEKYPCWSLPDLSSFKERFGFDDYENRLDVIGIDEAQFFGDLYEFCREAADKEGKTVIVAGLDGDFMRRRFGSVLDLIPIADTVTKLTSRCEVCGKRALFTMRKTEEKETELIGGAEVYMPVCRSHYVCGQNVLETARAVLDSSNNHSVVASSL mint FCEB4FC1AF5FC695 kitha_arath Thymidine kinase a TK1A F17A17.14 MLP3.25 At3g07800 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATLKASFLIKTLDSDVTGDFLSDLERRGSGAVHVIMGPMFSGKSTSLLRRIKSEISDGRSVAMLKSSKDTRYAKDSVVTHDGIGFPCWALPDLMSFPEKFGLDAYNKLDVIGIDEAQFFGDLYEFCCKVADDDGKIVIVAGLDGDYLRRSFGAVLDIIPIADSVTKLTARCEVCGHKAFFTLRKNCDTRTELIGGADVYMPVCRKHYITNHIVIKASKKVLEDSDKARAESCVAATI D27E84291427A62C q5i0a2_xentr Thymidine kinase TEgg105a12.1-001 tk1 protein protein xentr Xenopus tropicalis (Western clawed frog) Silurana tropicalis MNCLNVPEIMPGSPSKSRGQIQVIFGPMFSGKSTELMRRVRRFQIAQYKCMLIKYAKDTRYSKEHLATHDQNTMAAVSACQLRDVSAEALACSVIGIDEGQFFPDIVDFCEEMANRGKTMIVAALDGTFQRKAFGNILNLVPLAESVVKLNSVCMECYREAAYTKRLGAEKEVEVIGGAEKYHSVCRLCFFKNQQLPVEKENVLSHNALDTISLKLSNKLQTACSPRKPLAQRQCL mint 03CA331EB46F8046 kith_rat Thymidine kinase, cytosolic Tk1 Tk-1 protein protein rat Rattus norvegicus (Rat) Rat MSYINLPTVLPISPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYSNSFSTHDRNTMDALPACMLKDVAQEALGVAVIGIDEGQFFPDIVDFCETMANTGKTVIV mint 8330BDFD9CDA9EB0 kith_chick Thymidine kinase, cytosolic TK1 protein protein chick Gallus gallus (Chicken) Chicken MNCLTVPGVHPGSPGRPRGQIQVIFGPMFSGKSTELMRRVRRFQLAQYRCLLVKYAKDTRYCTTGVSTHDRNTMEARPACALQDVYQEALGSAVIGIDEGQFFPDIVEFCEKMANTGKTVIVAALDGTFQRKAFGSILNLVPLAESVVKLNAVCMECYREASYTKRLGAEREVEVIGGADKYHSVCRACYFQKRPQQLGSENKENVPMGVKQLDMPASRKIFAS mint BF29BEED2892BCF6 q803y1_danre Thymidine kinase tk1 TK1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MDCLNVARILPNSPRKTRGQIQVIFGPMFSGKSTELMRRVRRFQVAQYSCLLIKYAKDTRYSCTGMATHDMNTMEAVPANRLRDVAPLALQACVIGIDEGQFFPDTVEFCEEMANMGKTIIVAALDGTFQRKAFGNILNLVPLAESVVKLNAVCMQCFKEAAYTKRLGAEKEVEVIGGSDKYHAVCRCCYGGLMKENRSPQREETPPHASAAKTLEYSTATRKLFTALHL mint 8552AF96FCD8C6AE c3val3_anoca Thymidine kinase TK1 protein protein anoca Anolis carolinensis MNCLMMPGVQPGSPRKARGQIQVIFGPMFSGKSTELMRRVRRFQIAQYKCLLIKYAKDTRYCVNGVSTHDRNTMEAVSACCLKDVHQEALSSAVIGIDEGQFFPDIIEFCEAMANAGKTVIVAALGGTFQRKAFGNILHLVPLAESVVKLNAVCMECFREASYTKRLGAEKEVEVIGGADKYHSVCRVCYFKKRPQQPTENKENLPSGHKQLEPTASRKVLGICQNMQWGPSN mint 0DD4A85437AF0A18 q0h0h6_bacce Thymidine kinase CJ306_28485 NCTC7464_02567 F8172_17950 BKK64_12090 COK98_18730 CON37_06430 DR116_0009955 tdk2 A9485_15835 AT268_20020 BLX06_03770 CN357_30570 CN980_06535 COC69_01765 COD77_24400 COI98_09330 CON36_03255 tdk TU58_06975 WR52_27175 FC695_06390 FC702_23420 C6Y54_21655 D0437_26050 FC692_22460 C1N66_11430 C6A78_14085 protein protein bacce Bacillus cereus MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNGLKVKAVPVSASKDIFEHITEELDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKLQAVCSVCGSPASRTQRLIDGEPAAFDDPIILVGASESYEPRCRHCHAVPANKDK mint 937F6D890890302E g5eez5_caeel Thymidine kinase thk-1 4L44 CELE_Y43C5A.5 Y43C5A.5 protein protein caeel Caenorhabditis elegans MDIEAAKNEMTCCSSNSSLSDFNTLPRCPNRVGSITVILGPMFSGKTTELLRLHDRQIIAKRTCVLVKYAGDTRYDADLVATHSKMTGQGRTVKAHRLSEVQSQIFNDEVQVVSIDEGQFFEDLAETCEELAQRGKVVCVAALNGTFERKPFPQISLLLPYANEIKQVTAVCVECGSQANFSFRSTLDKKVEVIGGSDTYTALCRECYVQKSEEKDAEEQMKTGCDKNENDITGIFLAKKEQRSDGSVSPPRKKIGLSKSMALEATART mint A6F75D8B39E6CAA3 kith_dicdi Thymidine kinase 1 thyB Calmodulin-binding protein ThyB DDB_G0289179 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MIVTQIAGKIQVIFGPMFSGKTTELIRRIKRFNFANKKCLLIKYSKDTRYNDNIDKSFLVTHDKQNYQAFPCSILEDVKEQAQNYDVIGIDEGQFFPDVVQFSEDLANQGKTVIIAALDGTFQRKPFQSVIDLVSKAEYITKLTAVCMVCYNEAAFSKRIVESDDIELIGGIDKYISVCRGCYNSDQNEGNSTKPSKTARHSHSQSAPSVAPLAVNINPDDHLNNDY mint CF96E644406C0772 tdk-1 1 BcTK1 9 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction T2 F2 mint Gel-filtration analysis showed that BcTK1 ATP and BcTK1+ATP eluted with molecular masses of 43 kDa and 59 kDa, respectively (Figure 2). These masses correspond to relative masses of 2.0 and 2.7, respectively, and indicate that the native form of BcTK1 is a dimer, f17a17.14 1 AtTK1a 3 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction T2 F2 mint Both TK1 genes present in A. thaliana encoded active enzymes. The gel-filtration analysis showed different elution profiles, however. AtTK1a ATP eluted as two peaks of 52 and 32 kDa. These masses correspond to relative masses of 2 and 1.2, respectively, which indicate that AtTK1 ATP occurs as a mixture of a dimer and a monomer. q9fn47 1 AtTK1b-dN45 2 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction T2 F2 mint With AtTK1b, both the ATP and +ATP forms eluted as single peaks with the similar masses of 49 kDa giving relative masses of 1.6 for both forms. This suggests that AtTK1b is a dimer irrespective of the presence of ATP. thyb 1 DdTK1 11 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction T2 F2 mint This showed that DdTK1 occurred as a dimer regardless of the presence of ATP. thk 1 CeTK1 10 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction T2 F2 mint CeTK1 eluted as a tetramer, in the absence as well as in the presence of ATP. tk1-1 1 DrTK1 7 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction T2 F2 mint The elution profiles for DrTK1 indicated tetrameric forms for both the ATP and the +ATP TK1. tk1-1 1 XtTK1 4 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction T2 F2 mint XtTK1 ATP eluted with two peaks with masses of 98 kDa and 64 kDa, giving relative masses of 3.7 and 2.4. This indicated that XtTK1-ATP occurred both as a tetramer and a dimer. tk1-1 1 AcTK1 8 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction T2 F2 mint AcTK1 showed a dimer-tetramer pattern in its elution profile. Without ATP, the peak of the elution profile corresponded to a mass of 57 kDa giving a relative mass of 2.2, indicating a dimer. The rather broad profile and the shoulder at about 200 kDa suggested a mixture of different masses, predominated by the dimer. In the presence of ATP, the profile was narrow with one sharp peak that corresponds to a mass of 91 and a relative mass of 3.5, which indicated a tetramer form. tk1-1 1 GgTK1 6 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction T2 F2 mint The chicken TK1 had a clear pattern of ATP dependent oligomerization from a dimer to a tetramer. tk1-1 1 RnTK1 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction T2 F2 mint In absence of ATP, rat TK1 eluted with a molecular mass of 55 kDa giving a relative mass of 2.1 corresponding to a dimer. In presence of ATP, the elution profile gave a molecular mass of 95.2 kDa, and this gave a relative mass of 3.7 corresponding to a tetramer. tk1-1 1 XtTK1 4 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction T2 F2 mint XtTK1 ATP eluted with two peaks with masses of 98 kDa and 64 kDa, giving relative masses of 3.7 and 2.4. This indicated that XtTK1-ATP occurred both as a tetramer and a dimer. tk1-1 1 AcTK1 8 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction T2 F2 mint AcTK1 showed a dimer-tetramer pattern in its elution profile. Without ATP, the peak of the elution profile corresponded to a mass of 57 kDa giving a relative mass of 2.2, indicating a dimer. The rather broad profile and the shoulder at about 200 kDa suggested a mixture of different masses, predominated by the dimer. In the presence of ATP, the profile was narrow with one sharp peak that corresponds to a mass of 91 and a relative mass of 3.5, which indicated a tetramer form. tk1-1 1 GgTK1 6 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction T2 F2 mint The chicken TK1 had a clear pattern of ATP dependent oligomerization from a dimer to a tetramer. tk1-1 1 RnTK1 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction T2 F2 mint In absence of ATP, rat TK1 eluted with a molecular mass of 55 kDa giving a relative mass of 2.1 corresponding to a dimer. In presence of ATP, the elution profile gave a molecular mass of 95.2 kDa, and this gave a relative mass of 3.7 corresponding to a tetramer.