IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Differential regulation of distinct Vps34 complexes by AMPK in nutrient stress and autophagy. Differential regulation of distinct Vps34 complexes by AMPK in nutrient stress and autophagy. Cell (0092-8674) 2013 imex curation Kim J., Kim Y.C., Fang C., Russell R.C., Kim J.H., Fan W., Liu R., Zhong Q., Guan K.L. Tried to capture 1C but it was wrong however I did it so have ignored it in the end. Author written to but no response, so most of this paper could not be curated. Interactions involving protein constructs have not been added as the source of these constructs could not be traced. kuguan@ucsd.edu 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mcf10a Human non-transformed breast epithelial cell line mcf10a non-transformed human breast epithelial cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim J., Kim Y.C., Fang C., Russell R.C., Kim J.H., Fan W., Liu R., Zhong Q., Guan K.L. Tried to capture 1C but it was wrong however I did it so have ignored it in the end. Interactions involving protein constructs have not been added as the source of these constructs could not be traced. kuguan@ucsd.edu Accepted 2015-NOV-26 AT 14:37 GMT AT 14:37 GMT by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation Differential regulation of distinct Vps34 complexes by AMPK in nutrient stress and autophagy. Differential regulation of distinct Vps34 complexes by AMPK in nutrient stress and autophagy. Cell (0092-8674) 2013 imex curation Kim J., Kim Y.C., Fang C., Russell R.C., Kim J.H., Fan W., Liu R., Zhong Q., Guan K.L. Tried to capture 1C but it was wrong however I did it so have ignored it in the end. Author written to but no response, so most of this paper could not be curated. Interactions involving protein constructs have not been added as the source of these constructs could not be traced. kuguan@ucsd.edu 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim J., Kim Y.C., Fang C., Russell R.C., Kim J.H., Fan W., Liu R., Zhong Q., Guan K.L. Tried to capture 1C but it was wrong however I did it so have ignored it in the end. Interactions involving protein constructs have not been added as the source of these constructs could not be traced. kuguan@ucsd.edu Accepted 2015-NOV-26 AT 14:37 GMT AT 14:37 GMT by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation Differential regulation of distinct Vps34 complexes by AMPK in nutrient stress and autophagy. Differential regulation of distinct Vps34 complexes by AMPK in nutrient stress and autophagy. Cell (0092-8674) 2013 imex curation Kim J., Kim Y.C., Fang C., Russell R.C., Kim J.H., Fan W., Liu R., Zhong Q., Guan K.L. Tried to capture 1C but it was wrong however I did it so have ignored it in the end. Author written to but no response, so most of this paper could not be curated. Interactions involving protein constructs have not been added as the source of these constructs could not be traced. kuguan@ucsd.edu 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim J., Kim Y.C., Fang C., Russell R.C., Kim J.H., Fan W., Liu R., Zhong Q., Guan K.L. Tried to capture 1C but it was wrong however I did it so have ignored it in the end. Interactions involving protein constructs have not been added as the source of these constructs could not be traced. kuguan@ucsd.edu Accepted 2015-NOV-26 AT 14:37 GMT AT 14:37 GMT by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation Differential regulation of distinct Vps34 complexes by AMPK in nutrient stress and autophagy. Differential regulation of distinct Vps34 complexes by AMPK in nutrient stress and autophagy. Cell (0092-8674) 2013 imex curation Kim J., Kim Y.C., Fang C., Russell R.C., Kim J.H., Fan W., Liu R., Zhong Q., Guan K.L. Tried to capture 1C but it was wrong however I did it so have ignored it in the end. Author written to but no response, so most of this paper could not be curated. Interactions involving protein constructs have not been added as the source of these constructs could not be traced. kuguan@ucsd.edu 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim J., Kim Y.C., Fang C., Russell R.C., Kim J.H., Fan W., Liu R., Zhong Q., Guan K.L. Tried to capture 1C but it was wrong however I did it so have ignored it in the end. Interactions involving protein constructs have not been added as the source of these constructs could not be traced. kuguan@ucsd.edu Accepted 2015-NOV-26 AT 14:37 GMT AT 14:37 GMT by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation pk3c3_human Phosphatidylinositol 3-kinase catalytic subunit type 3 PIK3C3 Phosphoinositide-3-kinase class 3 Phosphatidylinositol 3-kinase p100 subunit VPS34 hVps34 protein protein human Homo sapiens Human MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKKDSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK DIP protein Q8NEB9 original sequence version: 73 DIP protein Q8NEB9 original sequence version: 78 DIP protein Q8NEB9 original sequence version: 100 DIP protein Q8NEB9 original sequence version: 113 1C03D97338E44976 uvrag_mouse UV radiation resistance-associated protein Uvrag1 Uvrag protein protein mouse Mus musculus Mouse MSSCASLGGPVPLPPPGPSAALTSGAPARALHVELPSQQRRLRHLRNIAARNIVNRNGHQLLDTYFTLHLCDNEKIFKEFYRSEVIKNSLNPTWRSLDFGIMPDRLDTSVSCFVVKIWGGKEEAFQLLIEWKVYLDGLKYLGQQIHARNQNEIIFGLNDGYYGAPCEHKGHPNAQKNLLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQRLGKEIEEKLRLTSTSNELKKESECLRLKILVLRNELERQKKALGREVAFLHKQQMALQDKGSAFSTEHGKLQLQKDSLSELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNENKDYFVCGVKLPNSEDFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKLQFDYGVYLLNKNIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHISNAIPVPKRQSSTFGGADGGFSAGIPSPDKVHRKRASSENERLQYKTPPPSYNSALTQPGVAMPTSGDSERKVAPLSSSLDTSLDFSKENKKAGVDLGSSVSGDHGNSDSGQEQGEALPGHLAAVNGTALPSEQAGPAGTLLPGSCHPAPSAELCCAVEQAEEIIGLEATGFTSGDQLEALSCIPVDSAVAVECDEQVLGEFEEFSRRIYALSENVSSFRRPRRSSDK 245A411198286F33 becn1_mouse Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Becn1 protein protein mouse Mus musculus Mouse MEGSKASSSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEEANSGEEPFIETRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQRELKELALEEERLIQELEDVEKNRKVVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQVRYAQIQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK DIP protein O88597 original sequence version: 116 DIP protein O88597 original sequence version: 93 14623BA002E1AAEE bakor_mouse Beclin 1-associated autophagy-related key regulator Atg14 D14Ertd436e Kiaa0831 Autophagy-related protein 14-like protein Atg14L protein protein mouse Mus musculus Mouse MASPSGKGSWTPEAPGFGPRALARDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQSGDFVYFDGRDRERFIDKKERLSQLKNKQEEFQKEVLKAMEGKRLTDQLRWKIMSCKMRIEQLKQTICKGNEEMKKNSEGLLKNKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKTIDLKSHYERLARLRRSHILELTSIIFPIDEVKTSGRDPADVSSETDSAMTSSMVSKLAEARRTTYLSGRWVCDDHNGDTSISITGPWISLPNNGDYSAYYNWVEEKKTTQGPDMEHNNPAYTISAALGYATQLVNIVSHILDINLPKKLCNSEFCGENLSKQKLTRAVRKLNANILYLCSSQHVNLDQLQPLHTLRNLMHLVSPRSEHLGRSGPFEVRADLEESMEFVDPGVAGESDASGDERVSDEETDLGTDWENLPSPRFCDIPSQPVEVSQSQSTQVSPPIASSSAGGMISSAAASVTSWFKAYTGHR DIP protein Q8CDJ3 original sequence version: 76 A221B3C03C8E2F9A becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK DIP protein Q14457 original sequence version: 95 DIP protein Q14457 original sequence version: 156 DIP protein Q14457 original sequence version: 122 DIP protein Q14457 original sequence version: 120 DIP protein Q14457 original sequence version: 133 DIP protein Q14457 original sequence version: 141 DIP protein Q14457 original sequence version: 106 ABF0C2DD7087473C pk3c3_mouse Phosphatidylinositol 3-kinase catalytic subunit type 3 Vps34 Pik3c3 Phosphoinositide-3-kinase class 3 protein protein mouse Mus musculus Mouse MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGSAVPVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTRTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNATTRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKKDSQTSASESLSNSGVSSGDIDSSQIITNPLPPVASPPPASKAKEVSDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSETGPYGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK DIP protein Q6PF93 original sequence version: 92 80E8EF9EF3AF74D7 pi3r4_mouse Phosphoinositide 3-kinase regulatory subunit 4 Vps15 Pik3r4 protein protein mouse Mus musculus Mouse MGNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKHREGLVVVKVFAIQDPTLPLTSYKQELEELKIRLHSAQNCLPFQKAAEKASEKAAMLFRQYVRDNLYDRISTRPFLNNIEKRWIAFQILTAVDQAHKSGVRHGDIKTENVMVTSWNWVLLTDFASFKPTYLPEDNPADFNYFFDTSRRRTCYIAPERFVDGGMFATELEYMRDPSTPLVDLNSNQRARGELKRAMDIFSAGCVIAELFTEGVPLFDLSQLLAYRNGHFFPEQVLNKIEDRSIRDLVTQMINREPEKRLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSADERILVIRKDLGNIIHNLCGHDLPEKAEGESRASGLVVLVSVITSCLQTLKSCDSKLAALELILHLAPRLSVEILLDRITPYLLHFSNDSVPRVRAEALRTLTKVLALVQEVPRNDVNIYPEYILPGIAHLAQDDATIVRLAYAENIALLAETALRFLELVQLKTLNMENEPDNEEVDEATRPNGDYDTELQALHEMVQQKVVTLLSDPENIVKQTLMESGITRLCVFFGRQKANDVLLSHMITFLNDKNDWHLRGAFFDSIVGVAAYVGWQSSSILKPLLQQGLSDAEEFVIVKALNALTCMCQLGLLQKPHVYEFASDIAPFLCHPNLWIRYGAVGFITVVAHQISTADVYCKLMPYLDPYITQPVIQIERKLVLLSVLKEPVSRSIFDYALRSKDIASLFRHLHMRQKKRNGSLLDCPPPEDPTIAQLLKKLLSQGMTEEEEDKLLALKDFMMKSNRAKANAVDQSHLHDSSQKGVIDLAALGITGRQVDLVKTKQEPDEKRARKHVKQDSNVNEEWKSMFGSLEPPNIPQALPKTSDHEVVQPGKPPRSESSAGICVPLSTSPQVSEAAHIPSKKPVIPVVSSTVLPSTYQIRITTCKTELQQLIQQKREQCNAERIAKQMMENAEWESKPPPPGWRPKGLLVAHLHEHKSAVNRIRVSDEHLLFATCSNDGTVKIWNSQKMEGKTTTTRSILTYSRIGGRVKTLTFCQGSHYLAIASDNGAVQLLGIEASKLPKSPKIHPLQSRILDQKEDGCVVDMHHFNSGAQSVLAYATVNGSLVGWDLRSSSNAWTLKHDLKSGLITSFAVDIHQCWLCIGTSSGAMACWDMRFQLPISSHCHPSRARIRRLSMHPLYQSWVIAAVQGNNEVSMWDMETGDRRLTLWASSAPPLSELQPSPHSVHGIYCSPADGNPILLTAGSDMKIRFWDLVSPERSYVVAGSTGSPSVSYYKKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDIATFQTTQGFIVTASRDGIVKVWK DIP protein Q8VD65 original sequence version: 106 113FC5EBBDA01E19 bakor_human Beclin 1-associated autophagy-related key regulator KIAA0831 Autophagy-related protein 14-like protein ATG14 ATG14L protein protein human Homo sapiens Human MASPSGKGARALEAPGCGPRPLARDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQSGDFVYFDGRDRERFIDKKERLSRLKSKQEEFQKEVLKAMEGKWITDQLRWKIMSCKMRIEQLKQTICKGNEEMEKNSEGLLKTKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKTIDLRSHYERLANLRRSHILELTSVIFPIEEVKTGVRDPADVSSESDSAMTSSTVSKLAEARRTTYLSGRWVCDDHNGDTSISITGPWISLPNNGDYSAYYSWVEEKKTTQGPDMEQSNPAYTISAALCYATQLVNILSHILDVNLPKKLCNSEFCGENLSKQKFTRAVKKLNANILYLCFSQHVNLDQLQPLHTLRNLMYLVSPSSEHLGRSGPFEVRADLEESMEFVDPGVAGESDESGDERVSDEETDLGTDWENLPSPRFCDIPSQSVEVSQSQSTQASPPIASSSAGGMISSAAASVTSWFKAYTGHR DIP protein Q6ZNE5 original sequence version: 50 DIP protein Q6ZNE5 original sequence version: 103 DIP protein Q6ZNE5 original sequence version: 73 A3EAB0580077D7A6 pik3c3-becn1-2 2 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association Fig. 1B, Supp Fig. 1A pik3r4-atg14-1 2 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey ser-91,ser-94 (observed) opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey association association Fig. 1B, Supp. Fig. 1A, 1D becn1-atg14-9 2 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait ser-91,ser-94 (observed) opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association Fig. 1B, 5A, 5E, Supp Fig. 1D uvrag-becn1-7 2 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey association association Fig. 1B pik3c3-becn1-4 4 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Supp Fig. 1A There is a shadow on the ATG14L track but the author says none so I've not added it. pik3c3-becn1-5 3 9 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association Supp Fig. 1A pik3c3-atg14-2 1 9 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association Supp Fig. 1A atg14-becn1-15 4 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey association association Supp Fig. 1A atg14-becn1-16 3 9 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait association association Supp Fig. 1A atg14-becn1-17 1 9 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait association association Supp Fig. 1A