IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ TMHS is an integral component of the mechanotransduction machinery of cochlear hair cells. TMHS is an integral component of the mechanotransduction machinery of cochlear hair cells. Cell (0092-8674) 2012 imex curation Xiong W., Grillet N., Elledge H.M., Wagner T.F., Zhao B., Johnson K.R., Kazmierczak P., Müller U. Source of PCDH15 derived from primers. umueller@scripps.edu 27-Mar-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xiong W., Grillet N., Elledge H.M., Wagner T.F., Zhao B., Johnson K.R., Kazmierczak P., Müller U. Source of PCDH15 derived from primers. umueller@scripps.edu Accepted 2013-MAR-25 by MGT 27-Mar-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation TMHS is an integral component of the mechanotransduction machinery of cochlear hair cells. TMHS is an integral component of the mechanotransduction machinery of cochlear hair cells. Cell (0092-8674) 2012 imex curation Xiong W., Grillet N., Elledge H.M., Wagner T.F., Zhao B., Johnson K.R., Kazmierczak P., Müller U. Source of PCDH15 derived from primers. umueller@scripps.edu 27-Mar-2013: Contacted by IntAct-Help. Only protein-protein interactions human-rpmi2650 Human nasal septum carcinoma cell line RPMI-2650 rpmi2650 Human nasal septum carcinoma cell line RPMI-2650 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Xiong W., Grillet N., Elledge H.M., Wagner T.F., Zhao B., Johnson K.R., Kazmierczak P., Müller U. Source of PCDH15 derived from primers. umueller@scripps.edu Accepted 2013-MAR-25 by MGT 27-Mar-2013: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation lhpl5_mouse LHFPL tetraspan subfamily member 5 protein Lhfpl5 Tmhs Lipoma HMGIC fusion partner-like 5 protein Tetraspan membrane protein of hair cell stereocilia protein protein mouse Mus musculus Mouse MVKLLPAQEAAKIYHTNYVRNSRAVGVMWGTLTICFSVLVMALFIQPYWIGDSVSTPQAGYFGLFSYCVGNVLSSELICKGGPLDFSSIPSRAFKTAMFFVALAMFLIIGSIICFSLFFVCNTATVYKICAWMQLAAATGLMIGCLVYPDGWDSSEVRRMCGEQTGKYTLGHCTIRWAFMLAILSIGDALILSFLAFVLGYRQDKLLPDDYKADGNEEV 9BFC49260AE9DD02 pcd15_mouse Protocadherin-15 Pcdh15 protein protein mouse Mus musculus Mouse MFLQFAVWKCLPHGILIASLLVVSWGQYDDDWQYEDCKLARGGPPATIVAIDEESRNGTILVDNMLIKGTAGGPDPTIELSLKDNVDYWVLLDPVKQMLFLNSTGRVLDRDPPMNIHSIVVQVQCVNKKVGTVIYHEVRIVVRDRNDNSPTFKHESYYATVNELTPVGTTIFTGFSGDNGATDIDDGPNGQIEYVIQYNPEDPTSNDTFEIPLMLTGNVVLRKRLNYEDKTRYYVIIQANDRAQNLNERRTTTTTLTVDVLDGDDLGPMFLPCVLVPNTRDCRPLTYQAAIPELRTPEELNPILVTPPIQAIDQDRNIQPPSDRPGILYSILVGTPEDYPRFFHMHPRTAELTLLEPVNRDFHQKFDLVIKAEQDNGHPLPAFASLHIEILDENNQSPYFTMPSYQGYILESAPVGATISESLNLTTPLRIVALDKDIEDTKDPELHLFLNDYTSVFTVTPTGITRYLTLLQPVDREEQQTYTFLITAFDGVQESEPVVVNIRVMDANDNTPTFPEISYDVYVYTDMSPGDSVIQLTAVDADEGSNGEISYEILVGGKGDFVINKTTGLVSIAPGVELIVGQTYALTVQASDNAPPAERRHSICTVYIEVLPPNNQSPPRFPQLMYSLEVSEAMRIGAILLNLQATDREGDPITYAIENGDPQRVFNLSETTGILSLGKALDRESTDRYILIVTASDGRPDGTSTATVNIVVTDVNDNAPVFDPYLPRNLSVVEEEANAFVGQVRATDPDAGINGQVHYSLGNFNNLFRITSNGSIYTAVKLNREARDHYELVVVATDGAVHPRHSTLTLYIKVLDIDDNSPVFTNSTYTVVVEENLPAGTSFLQIEAKDVDLGANVSYRIRSPEVKHLFALHPFTGELSLLRSLDYEAFPDQEASITFLVEAFDIYGTMPPGIATVTVIVKDMNDYPPVFSKRIYKGMVAPDAVKGTPITTVYAEDADPPGMPASRVRYRVDDVQFPYPASIFDVEEDSGRVVTRVNLNEEPTTIFKLVVVAFDDGEPVMSSSATVRILVLHPGEIPRFTQEEYRPPPVSELAARGTVVGVISAAAINQSIVYSIVAGNEEDKFGINNVTGVIYVNSPLDYETRTSYVLRVQADSLEVVLANLRVPSKSNTAKVYIEIQDENDHPPVFQKKFYIGGVSEDARMFASVLRVKATDRDTGNYSAMAYRLIIPPIKEGKEGFVVETYTGLIKTAMLFHNMRRSYFKFQVIATDDYGKGLSGKADVLVSVVNQLDMQVIVSNVPPTLVEKKIEDLTEILDRYVQEQIPGAKVVVESIGARRHGDAYSLEDYSKCDLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQPYYGEGGRILEIRTPEAVTSIKKRGESLGYTEGALLALAFIIILCCIPAILVVLVSYRQFKVRQAECTKTARIQSAMPAAKPAAPVPAAPAPPPPPPPPPPGAHLYEELGESAMHNLFLLYHFEQSRGNNSVPEDRSSHRDGMAFSSSTTESHEPAHVEGPLKESQPNPARTFSFVPDEDNLSTHNPLYMESIGQRSTNSDLQPRTDFEELLAPRTQVKSQSLRGPREKIQRVWNQSVSFPRRLMWKAPNRPETIDLVEWQITNQRAECESARCHPSQRGSSNVLLATEDAHESEKEGGHRDTLIVQQTEQLKSLSSGSSFSSSWSHFSFSTLPTISRAVELGSEPNVVTSPADCTLELSPPLRPRILNSLSSKRETPTCASDTEPKRNSFEIAPHPPSISAPLPHPPLPRPPIAFTTFPLPLSPPNPPPPQLVTFSLPISTPPTSSLPLPPPLSLPPPPRPPAPRLFPQPPSTSIPSTDSISAPAAKCTASATHARETTSTTQPPASNPQWGAEPHRHPKGILRHVKNLAELEKSVSNMYSHIEKNCPPADPSKLHTFCPAEKTGMKITHDQSQETLVRVVEGIDVQPHSQSTSL DIP protein Q99PJ1 original sequence version: 101 DIP protein Q99PJ1 original sequence version: 74 DIP protein Q99PJ1 original sequence version: 82 DIP protein Q99PJ1 original sequence version: 95 6FD6836082655855 lhfpl5-pcdh15 1 3 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey conserved region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3C, 3D, 4D The cytoplasmic region of the PCDH15 molecule could be divided into the CD3 and CR sub-regions, both of which appeared to interact with TMHS, but these could not be mapped to specific coordinates. lhfpl5-pcdh15-1 2 3 unspecified role unspecified role neutral component neutral component Q4KL25:p.Cys161Phe mutation mutation certain certain sequence position certain certain certain sequence position certain C F Wed May 02 18:18:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys161phe' Tue Jun 30 20:15:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys161Phe' 4 unspecified role unspecified role neutral component neutral component colocalization colocalization The hurry-scurry mutation is described in the figure legend 4E to be Tyr161Cys, in all other sources, including the remainder of this paper, it is Cys161Phe, which correlates with the given sequence so the legend to 4E has been assumed to be an error. Fig. 4Ad–4Ai, 4E TMHS carrying the hurry-scurry mutation in still colocalized with PCDH15, but the protein complex remained in aggregates within the cytoplasm.