IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. Cell (0092-8674) 2012 imex curation Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org 8-May-2012: Contacted by IntAct-Help. Only protein-protein interactions nicbe-leaf Nicotiana benthamiana leaf leaf leaf bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. no y2h data suggests this interaction is indirect so uniprot-export=no weigel@weigelworld.org Accepted 2013-APR-30 by PPORRAS 8-May-2012: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. Cell (0092-8674) 2012 imex curation Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org 8-May-2012: Contacted by IntAct-Help. Only protein-protein interactions arath-leaf Arabidopsis thaliana leaf leaf leaf anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org Accepted 2013-APR-30 by PPORRAS 8-May-2012: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. Cell (0092-8674) 2012 imex curation Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org 8-May-2012: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 hybrid three hybrid 3-hybrid tri hybrid tri-hybrid assay 3 hybrid predetermined predetermined participant predetermined Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org Accepted 2013-APR-30 by PPORRAS 8-May-2012: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. Cell (0092-8674) 2012 imex curation Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org 8-May-2012: Contacted by IntAct-Help. Only protein-protein interactions arath-leaf Arabidopsis thaliana leaf leaf leaf anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. Presence of CPL1 confirmed by anti-tag western. weigel@weigelworld.org Accepted 2013-APR-30 by PPORRAS 8-May-2012: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. Cell (0092-8674) 2012 imex curation Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org 8-May-2012: Contacted by IntAct-Help. Only protein-protein interactions nicbe-leaf Nicotiana benthamiana leaf leaf leaf bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org Accepted 2013-APR-30 by PPORRAS 8-May-2012: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. Cell (0092-8674) 2012 imex curation Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org 8-May-2012: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org Accepted 2013-APR-30 by PPORRAS 8-May-2012: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. Cell (0092-8674) 2012 imex curation Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org 8-May-2012: Contacted by IntAct-Help. Only protein-protein interactions nicbe-leaf Nicotiana benthamiana leaf leaf leaf confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org Accepted 2013-APR-30 by PPORRAS 8-May-2012: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. Cell (0092-8674) 2012 imex curation Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org 8-May-2012: Contacted by IntAct-Help. Only protein-protein interactions arath-leaf Arabidopsis thaliana leaf leaf leaf anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. no y2h data suggests this interaction is indirect so uniprot-export=no weigel@weigelworld.org Accepted 2013-APR-30 by PPORRAS 8-May-2012: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation cpl1_arath RNA polymerase II C-terminal domain phosphatase-like 1 CPL1 FRY2 JOE1 Carboxyl-terminal phosphatase-like 1 Protein JASMONATE OVEREXPRESSING 1 Protein FIERY 2 Protein SHINY 4 SHI4 F17L22.130 At4g21670 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MYSNNRVEVFHGDGRLGELEIYPSRELNQQQDDVMKQRKKKQREVMELAKMGIRISHFSQSGERCPPLAILTTISSCGLCFKLEASPSPAQESLSLFYSSCLRDNKTAVMLLGGEELHLVAMYSENIKNDRPCFWAFSVAPGIYDSCLVMLNLRCLGIVFDLDETLVVANTMRSFEDKIDGFQRRINNEMDPQRLAVIVAEMKRYQDDKNLLKQYIESDQVVENGEVIKVQSEIVPALSDNHQPLVRPLIRLQEKNIILTRINPMIRDTSVLVRMRPSWEELRSYLTAKGRKRFEVYVCTMAERDYALEMWRLLDPEGNLINTNDLLARIVCVKSGFKKSLFNVFLDGTCHPKMALVIDDRLKVWDEKDQPRVHVVPAFAPYYSPQAEAAATPVLCVARNVACGVRGGFFRDFDDSLLPRIAEISYENDAEDIPSPPDVSHYLVSEDDTSGLNGNKDPLSFDGMADTEVERRLKEAISASSAVLPAANIDPRIAAPVQFPMASASSVSVPVPVQVVQQAIQPSAMAFPSIPFQQPQQPTSIAKHLVPSEPSLQSSPAREEGEVPESELDPDTRRRLLILQHGQDTRDPAPSEPSFPQRPPVQAPPSHVQSRNGWFPVEEEMDPAQIRRAVSKEYPLDSEMIHMEKHRPRHPSFFSKIDNSTQSDRMLHENRRPPKESLRRDEQLRSNNNLPDSHPFYGEDASWNQSSSRNSDLDFLPERSVSATETSADVLHGIAIKCGAKVEYKPSLVSSTDLRFSVEAWLSNQKIGEGIGKSRREALHKAAEASIQNLADGYMRANGDPGPSHRDATPFTNENISMGNANALNNQPFARDETALPVSSRPTDPRLEGSMRHTGSITALRELCASEGLEMAFQSQRQLPSDMVHRDELHAQVEIDGRVVGEGVGSTWDEARMQAAERALSSVRSMLGQPLHKRQGSPRSFGGMSNKRLKPDFQRSLQRMPSSGRYS 3FD10F0F3A73154D drb1_arath Double-stranded RNA-binding protein 1 F21M12.9 At1g09700 DRB1 HYL1 Protein HYPONASTIC LEAVES 1 dsRNA-binding protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTSTDVSSGVSNCYVFKSRLQEYAQKYKLPTPVYEIVKEGPSHKSLFQSTVILDGVRYNSLPGFFNRKAAEQSAAEVALRELAKSSELSQCVSQPVHETGLCKNLLQEYAQKMNYAIPLYQCQKVETLGRVTQFTCTVEIGGIKYTGAATRTKKDAEISAGRTALLAIQSDTKNNLANYNTQLTVLPCEKKTIQAAIPLKETVKTLKARKAQFKKKAQKGKRTVAKNPEDIIIPPQPTDHCQNDQSEKIETTPNLEPSSCMNGLKEAAFGSVETEKIETTPNLEPPSCMNGLKEAAFGSVETEKIETTPNLEPPSCMNGLKEAAFGSVETEKIETTPNLEPSSCMNGLKEAAFGSVETEKIETTPNLEPPSCMNGLKEAAFGSVETEKIETTPNLESSSCMSGLKEAAFGSVETEASHA DIP protein O04492 original sequence version: 65 FDBE165679537DFB dcl1_arath Endoribonuclease Dicer homolog 1 Protein CARPEL FACTORY Protein SHORT INTEGUMENTS 1 Protein SUSPENSOR 1 DCL1 ASU1 SUS1 At1g01040 T25K16.4 CAF SIN1 Dicer-like protein 1 Protein ABNORMAL SUSPENSOR 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVMEDEPREATIKPSYWLDACEDISCDLIDDLVSEFDPSSVAVNESTDENGVINDFFGGIDHILDSIKNGGGLPNNGVSDTNSQINEVTVTPQVIAKETVKENGLQKNGGKRDEFSKEEGDKDRKRARVCSYQSERSNLSGRGHVNNSREGDRFMNRKRTRNWDEAGNNKKKRECNNYRRDGRDREVRGYWERDKVGSNELVYRSGTWEADHERDVKKVSGGNRECDVKAEENKSKPEERKEKVVEEQARRYQLDVLEQAKAKNTIAFLETGAGKTLIAILLIKSVHKDLMSQNRKMLSVFLVPKVPLVYQQAEVIRNQTCFQVGHYCGEMGQDFWDSRRWQREFESKQVLVMTAQILLNILRHSIIRMETIDLLILDECHHAVKKHPYSLVMSEFYHTTPKDKRPAIFGMTASPVNLKGVSSQVDCAIKIRNLETKLDSTVCTIKDRKELEKHVPMPSEIVVEYDKAATMWSLHETIKQMIAAVEEAAQASSRKSKWQFMGARDAGAKDELRQVYGVSERTESDGAANLIHKLRAINYTLAELGQWCAYKVGQSFLSALQSDERVNFQVDVKFQESYLSEVVSLLQCELLEGAAAEKVAAEVGKPENGNAHDEMEEGELPDDPVVSGGEHVDEVIGAAVADGKVTPKVQSLIKLLLKYQHTADFRAIVFVERVVAALVLPKVFAELPSLSFIRCASMIGHNNSQEMKSSQMQDTISKFRDGHVTLLVATSVAEEGLDIRQCNVVMRFDLAKTVLAYIQSRGRARKPGSDYILMVERGNVSHAAFLRNARNSEETLRKEAIERTDLSHLKDTSRLISIDAVPGTVYKVEATGAMVSLNSAVGLVHFYCSQLPGDRYAILRPEFSMEKHEKPGGHTEYSCRLQLPCNAPFEILEGPVCSSMRLAQQAVCLAACKKLHEMGAFTDMLLPDKGSGQDAEKADQDDEGEPVPGTARHREFYPEGVADVLKGEWVSSGKEVCESSKLFHLYMYNVRCVDFGSSKDPFLSEVSEFAILFGNELDAEVLSMSMDLYVARAMITKASLAFKGSLDITENQLSSLKKFHVRLMSIVLDVDVEPSTTPWDPAKAYLFVPVTDNTSMEPIKGINWELVEKITKTTAWDNPLQRARPDVYLGTNERTLGGDRREYGFGKLRHNIVFGQKSHPTYGIRGAVASFDVVRASGLLPVRDAFEKEVEEDLSKGKLMMADGCMVAEDLIGKIVTAAHSGKRFYVDSICYDMSAETSFPRKEGYLGPLEYNTYADYYKQKYGVDLNCKQQPLIKGRGVSYCKNLLSPRFEQSGESETVLDKTYYVFLPPELCVVHPLSGSLIRGAQRLPSIMRRVESMLLAVQLKNLISYPIPTSKILEALTAASCQETFCYERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQFALVKGLQSYIQADRFAPSRWSAPGVPPVFDEDTKDGGSSFFDEEQKPVSEENSDVFEDGEMEDGELEGDLSSYRVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDDPDEVDGTLKNVNVPESVLKSIDFVGLERALKYEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLFFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTESSKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQAEGLEYKASRSGNTATVEVFIDGVQVGVAQNPQKKMAQKLAARNALAALKEKEIAESKEKHINNGNAGEDQGENENGNKKNGHQPFTRQTLNDICLRKNWPMPSYRCVKEGGPAHAKRFTFGVRVNTSDRGWTDECIGEPMPSVKKAKDSAAVLLLELLNKTFS EAA944F0C0C81D4C srrt_arath Serrate RNA effector molecule SE T20P8.15 At2g27100 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADVNLPPSDSVDNRLPEKSTSSSPPPPPPSSSLPQQEQEQDQQQLPLRRERDSRERRDERDIERPPPNRRERDRSPLPPPRRDYKRRPSLSPPPPYRDRRHSPPQRRSPPQKRYRRDDNGYDGRRGSPRGGYGPPDRRFGYDHGGGYDREMGGRPGYGDERPHGRFMGRYQDWEGGRGGYGDASNSGNPQRDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRAFFNTHKEEDWLKNKYHPTNLLSVIERRNDLAQKVAKDFLLDLQSGTLDLGPAVTALNKSGRTSEPNSEDEAAGVGKRKRHGMGGAKENELLSAAPKAPSFTSDPKRILTDVEQTQALVRKLDSEKKIEENVLQGSETEKSGREKLHSGSTGPVVIIRGLTSVKGLEGVELLDTLVTYLWRVHGLDYYGKVETNEAKGLRHVRAEGKVSDAKGDENESKFDSHWQERLKGQDPLEVMAAKEKIDAAATEALDPHVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHTELVTELTTKVREELYFQNYMNDPNAPGGQPATQQSGPRDRPIRRKPSMENRLRDDRGGRRERDGRANGNDRNDRSEDQQRGDNDGGNPGEVGYDAFGGQGGVHVPPFLSDINPPPMLMPVPGAGPLGPFVPAPPEVAMQMFRDPSGPNPPFEGSGRGGPAPFLLSPAFRQDPRRLRSYQDLDAPEEEVTVIDYRSL DIP protein Q9ZVD0 original sequence version: 81 44D7041FAEA4A857 cpl1-dcl1 7 11 unspecified role unspecified role neutral component neutral component n-terminal mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role neutral component neutral component c-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Fig. 3A, Supp. Fig. 3B, 3C cpl1-se 7 12 unspecified role unspecified role neutral component neutral component c-terminal mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role neutral component neutral component c-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Fig. 3A, Supp. Fig. 3B, 3C cpl1-drb1 7 9 unspecified role unspecified role neutral component neutral component c-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role neutral component neutral component c-terminal mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Fig. 3A, Supp. Fig. 3B, 3C cpl1-drb1-2 2 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait c-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Fig. 3C drb1-cpl1 4 9 unspecified role unspecified role prey prey c-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association Fig. 3C se-cpl1 4 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey c-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 12 unspecified role unspecified role bait bait association association Fig. 3C cpl1-drb1-3 1 9 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 3D cpl1-se-1 5 12 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3D drb1-se 5 10 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3D cpl1-se-2 6 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Fig. 4A cpl1-drb1-5 3 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role ancillary ancillary physical association physical association Fig. 4B se-drb1 6 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Fig. 4A drb1-cpl1-1 3 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 12 unspecified role unspecified role ancillary ancillary physical association physical association Fig. 4B cpl1-se-3 6 9 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Supp. Fig. 4 cpl1-drb1-6 8 9 unspecified role unspecified role bait bait c-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role prey prey physical association physical association Fig. 5A The hypophosphorylated form of HYL1 is enriched in the immunoprecipitate.