IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. J. Biol. Chem. (0021-9258) 2012 imex curation Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease Parkinsons - Interactions investigated in the context of Parkinsons disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. Interactions involving Tubulin have not been entered as the exact identity of Tubulin is not known. Tau has been entered as (Rat) UniProt ID P19332-5 (with 432 amino acids) -as identified from Kanai et al., 1992 and 1989. [Kanai-1989 (PMID:2504728), Figure 1 gives the complete sequence of pTAU-16 which has 432 amino acids.] chenjg@pku.edu.cn, junlinteng@pku.edu.cn 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Alzheimers - Interactions investigated in the context of Alzheimers disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. chenjg@pku.edu.cn, junlinteng@pku.edu.cn Accepted 2013-OCT-02 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. J. Biol. Chem. (0021-9258) 2012 imex curation Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease Parkinsons - Interactions investigated in the context of Parkinsons disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. Interactions involving Tubulin have not been entered as the exact identity of Tubulin is not known. Tau has been entered as (Rat) UniProt ID P19332-5 (with 432 amino acids) -as identified from Kanai et al., 1992 and 1989. [Kanai-1989 (PMID:2504728), Figure 1 gives the complete sequence of pTAU-16 which has 432 amino acids.] chenjg@pku.edu.cn, junlinteng@pku.edu.cn 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-neuron Mus musculus neuronal cell neuron Neuron [Neuronal cell; Neural cell fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Alzheimers - Interactions investigated in the context of Alzheimers disease Dorsal root ganglion neurons. The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. chenjg@pku.edu.cn, junlinteng@pku.edu.cn Accepted 2013-OCT-02 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. J. Biol. Chem. (0021-9258) 2012 imex curation Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease Parkinsons - Interactions investigated in the context of Parkinsons disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. Interactions involving Tubulin have not been entered as the exact identity of Tubulin is not known. Tau has been entered as (Rat) UniProt ID P19332-5 (with 432 amino acids) -as identified from Kanai et al., 1992 and 1989. [Kanai-1989 (PMID:2504728), Figure 1 gives the complete sequence of pTAU-16 which has 432 amino acids.] chenjg@pku.edu.cn, junlinteng@pku.edu.cn 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Alzheimers - Interactions investigated in the context of Alzheimers disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. chenjg@pku.edu.cn, junlinteng@pku.edu.cn Accepted 2013-OCT-02 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. J. Biol. Chem. (0021-9258) 2012 imex curation Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease Parkinsons - Interactions investigated in the context of Parkinsons disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. Interactions involving Tubulin have not been entered as the exact identity of Tubulin is not known. Tau has been entered as (Rat) UniProt ID P19332-5 (with 432 amino acids) -as identified from Kanai et al., 1992 and 1989. [Kanai-1989 (PMID:2504728), Figure 1 gives the complete sequence of pTAU-16 which has 432 amino acids.] chenjg@pku.edu.cn, junlinteng@pku.edu.cn 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Alzheimers - Interactions investigated in the context of Alzheimers disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. chenjg@pku.edu.cn, junlinteng@pku.edu.cn Accepted 2013-OCT-02 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. J. Biol. Chem. (0021-9258) 2012 imex curation Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease Parkinsons - Interactions investigated in the context of Parkinsons disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. Interactions involving Tubulin have not been entered as the exact identity of Tubulin is not known. Tau has been entered as (Rat) UniProt ID P19332-5 (with 432 amino acids) -as identified from Kanai et al., 1992 and 1989. [Kanai-1989 (PMID:2504728), Figure 1 gives the complete sequence of pTAU-16 which has 432 amino acids.] chenjg@pku.edu.cn, junlinteng@pku.edu.cn 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Alzheimers - Interactions investigated in the context of Alzheimers disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. chenjg@pku.edu.cn, junlinteng@pku.edu.cn Accepted 2013-OCT-02 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. J. Biol. Chem. (0021-9258) 2012 imex curation Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease Parkinsons - Interactions investigated in the context of Parkinsons disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. Interactions involving Tubulin have not been entered as the exact identity of Tubulin is not known. Tau has been entered as (Rat) UniProt ID P19332-5 (with 432 amino acids) -as identified from Kanai et al., 1992 and 1989. [Kanai-1989 (PMID:2504728), Figure 1 gives the complete sequence of pTAU-16 which has 432 amino acids.] chenjg@pku.edu.cn, junlinteng@pku.edu.cn 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain_hippocampal_neuron Mus musculus, brain, hippocampal neurons brain-hippocampus_neuron Hippocampal neuron fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Alzheimers - Interactions investigated in the context of Alzheimers disease Go terms: could not find exact term for some entrys ( e.g. axonal branch point). Have entered 'cytoskeleton' + 'cytosol' for all entries but left specific locations for individual figures. The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. chenjg@pku.edu.cn, junlinteng@pku.edu.cn Accepted 2013-OCT-02 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. J. Biol. Chem. (0021-9258) 2012 imex curation Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease Parkinsons - Interactions investigated in the context of Parkinsons disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. Interactions involving Tubulin have not been entered as the exact identity of Tubulin is not known. Tau has been entered as (Rat) UniProt ID P19332-5 (with 432 amino acids) -as identified from Kanai et al., 1992 and 1989. [Kanai-1989 (PMID:2504728), Figure 1 gives the complete sequence of pTAU-16 which has 432 amino acids.] chenjg@pku.edu.cn, junlinteng@pku.edu.cn 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Alzheimers - Interactions investigated in the context of Alzheimers disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. chenjg@pku.edu.cn, junlinteng@pku.edu.cn Accepted 2013-OCT-02 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. J. Biol. Chem. (0021-9258) 2012 imex curation Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease Parkinsons - Interactions investigated in the context of Parkinsons disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. Interactions involving Tubulin have not been entered as the exact identity of Tubulin is not known. Tau has been entered as (Rat) UniProt ID P19332-5 (with 432 amino acids) -as identified from Kanai et al., 1992 and 1989. [Kanai-1989 (PMID:2504728), Figure 1 gives the complete sequence of pTAU-16 which has 432 amino acids.] chenjg@pku.edu.cn, junlinteng@pku.edu.cn 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Alzheimers - Interactions investigated in the context of Alzheimers disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. chenjg@pku.edu.cn, junlinteng@pku.edu.cn Accepted 2013-OCT-02 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. J. Biol. Chem. (0021-9258) 2012 imex curation Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease Parkinsons - Interactions investigated in the context of Parkinsons disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. Interactions involving Tubulin have not been entered as the exact identity of Tubulin is not known. Tau has been entered as (Rat) UniProt ID P19332-5 (with 432 amino acids) -as identified from Kanai et al., 1992 and 1989. [Kanai-1989 (PMID:2504728), Figure 1 gives the complete sequence of pTAU-16 which has 432 amino acids.] chenjg@pku.edu.cn, junlinteng@pku.edu.cn 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Alzheimers - Interactions investigated in the context of Alzheimers disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. chenjg@pku.edu.cn, junlinteng@pku.edu.cn Accepted 2013-OCT-02 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation pacn1_mouse Protein kinase C and casein kinase substrate in neurons protein 1 Pacsin Pacsin1 Syndapin-1 protein protein mouse Mus musculus Mouse MSGSYDEASEEITDSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRWRQLIEKGPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEERLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQKTQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYMHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTAKKEKQPKKAEGATLSNATGAVESTSQAGDRGSVSSYDRGQTYATEWSDDESGNPFGGNEANGGANPFEDDAKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDEQGWCRGRLDSGQLGLYPANYVEAI DIP protein Q61644 original sequence version: 89 21BEB339A14A41F9 p19332-5 Microtubule-associated protein tau Mapt Mtapt Tau Neurofibrillary tangle protein Paired helical filament-tau protein protein rat Rattus norvegicus (Rat) Rat MAEPRQEFDTMEDQAGDYTMLQDQEGDMDHGLKESPPQPPADDGSEEPGSETSDAKSTPTAEDVTAPLVEERAPDKQATAQSHTEIPEGTTAEEAGIGDTPNMEDQAAGHVTQARVAGVSKDRTGNDEKKAKGADGKTGAKIATPRGAATPGQKGTSNATRIPAKTTPSPKTPPGSGEPPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSASKSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVHIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL BBBC0DF6D0394D72 tau_mouse Microtubule-associated protein tau Neurofibrillary tangle protein Paired helical filament-tau Mapt Mtapt Tau protein protein mouse Mus musculus Mouse MADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKESPPQPPADDGAEEPGSETSDAKSTPTAEDVTAPLVDERAPDKQAAAQPHTEIPEGITAEEAGIGDTPNQEDQAAGHVTQGRREGQAPDLGTSDWTRQQVSSMSGAPLLPQGLREATCQPSGTRPEDIEKSHPASELLRRGPPQKEGWGQDRLGSEEEVDEDLTVDESSQDSPPSQASLTPGRAAPQAGSGSVCGETASVPGLPTEGSVPLPADFFSKVSAETQASQPEGPGTGPMEEGHEAAPEFTFHVEIKASTPKEQDLEGATVVGVPGEEQKAQTQGPSVGKGTKEASLQEPPGKQPAAGLPGRPVSRVPQLKARVASKDRTGNDEKKAKTSTPSCAKAPSHRPCLSPTRPTLGSSDPLIKPSSPAVSPEPATSPKHVSSVTPRNGSPGTKQMKLKGADGKTGAKIATPRGAASPAQKGTSNATRIPAKTTPSPKTPPGSGEPPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSASKSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL 80C0D50AC5F64E6F mapt-pacsin1 9 10 unspecified role unspecified role prey prey mouse-brain Mus musculus brain brain Brain [cerebrum] 11 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range delta_microtubule_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Supp 1B mapt-pacsin1-1 7 11 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range delta_microtubule_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey mouse-brain Mus musculus brain brain Brain [cerebrum] physical association physical association 1A mapt-pacsin1-3 7 12 unspecified role unspecified role prey prey mouse-brain Mus musculus brain brain Brain [cerebrum] 10 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 1B mapt-pacsin1-4 1 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait delta_microtubule_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1C mapt-pacsin1-5 4 10 unspecified role unspecified role prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q61644:p.Pro434Leu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P L Wed May 02 17:25:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro434leu' Tue Jun 30 16:02:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro434Leu' mouse-brain Mus musculus brain brain Brain [cerebrum] 11 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range proline_rich_domain sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) direct interaction direct interaction 1E mapt-pacsin1-6 5 11 unspecified role unspecified role bait bait n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role prey prey n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1F pacsin1-mapt 5 10 unspecified role unspecified role bait bait n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1Fi pacsin1-mapt-1 8 10 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association 1G mapt-pacsin1-9 6 10 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization 2A/B mapt-pacsin1-10 2 12 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 2C/D mapt-pacsin1-11 3 10 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization Supp 3 Pascsin1 and tau co-localized in corpus callosa and mossy fibers in hippocampal region.