MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it End-binding protein 1 controls signal propagation from the T cell receptor. End-binding protein 1 controls signal propagation from the T cell receptor. EMBO J. (0261-4189) 2012 Martín-Cófreces NB., Baixauli F., López MJ., Gil D., Monjas A., Alarcón B., Sánchez-Madrid F. mouse-spleen Mus musculus spleen spleen spleen anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Martín-Cófreces NB., Baixauli F., López MJ., Gil D., Monjas A., Alarcón B., Sánchez-Madrid F. EMBO J. (0261-4189) 2012 End-binding protein 1 controls signal propagation from the T cell receptor. End-binding protein 1 controls signal propagation from the T cell receptor. EMBO J. (0261-4189) 2012 Martín-Cófreces NB., Baixauli F., López MJ., Gil D., Monjas A., Alarcón B., Sánchez-Madrid F. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid experimental particp experimental participant identification experimental particp Martín-Cófreces NB., Baixauli F., López MJ., Gil D., Monjas A., Alarcón B., Sánchez-Madrid F. EMBO J. (0261-4189) 2012 End-binding protein 1 controls signal propagation from the T cell receptor. End-binding protein 1 controls signal propagation from the T cell receptor. EMBO J. (0261-4189) 2012 Martín-Cófreces NB., Baixauli F., López MJ., Gil D., Monjas A., Alarcón B., Sánchez-Madrid F. human-ch7c17 t cells Homo sapiens ch7c17 t cells ch7c17 t cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Martín-Cófreces NB., Baixauli F., López MJ., Gil D., Monjas A., Alarcón B., Sánchez-Madrid F. EMBO J. (0261-4189) 2012 cd3z_human T-cell surface glycoprotein CD3 zeta chain T-cell receptor T3 zeta chain CD247 CD3Z T3Z TCRZ protein protein human Homo sapiens Human MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR 9408260374856EE9 ccr7_human C-C chemokine receptor type 7 CCR7 CMKBR7 EBI1 EVI1 BLR2 CDw197 Epstein-Barr virus-induced G-protein coupled receptor 1 MIP-3 beta receptor protein protein human Homo sapiens Human MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP DIP protein P32248 original sequence version: 139 D4CB4213841A1BD4 cd3e_human T-cell surface glycoprotein CD3 epsilon chain CD3E T3E T-cell surface antigen T3/Leu-4 epsilon chain protein protein human Homo sapiens Human MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI A1603D01CE9957D7 ccr7_mouse C-C chemokine receptor type 7 Epstein-Barr virus-induced G-protein coupled receptor 1 Ccr7 Cmkbr7 Ebi1 Ebi1h MIP-3 beta receptor protein protein mouse Mus musculus Mouse MDPGKPRKNVLVVALLVIFQVCFCQDEVTDDYIGENTTVDYTLYESVCFKKDVRNFKAWFLPLMYSVICFVGLLGNGLVILTYIYFKRLKTMTDTYLLNLAVADILFLLILPFWAYSEAKSWIFGVYLCKGIFGIYKLSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWMLALFLSIPELLYSGLQKNSGEDTLRCSLVSAQVEALITIQVAQMVFGFLVPMLAMSFCYLIIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITNSSCETSKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDLFKLFKDLGCLSQERLRHWSSCRHVRNASVSMEAETTTTFSP Receptor for the MIP-3-beta chemokine mint homomint F027451989B59683 ccr7-cd247 3 EBI1 5 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level CD3 zeta 4 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association homomint mint f1e f1d ccr7-cd247-1 1 EBI1 7 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level CD3 zeta 4 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association sf1b homomint mint T cells, EB1 was immunoprecipitated from murine thymocytes and spleen Tcell lysates. EB1 was found associated with CD3z in cells from both organs (Supplementary Figure S1B). cd247-ccr7 1 EBI1 7 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level CD3 zeta 4 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association homomint mint T cells, EB1 was immunoprecipitated from murine thymocytes and spleen Tcell lysates. EB1 was found associated with CD3z in cells from both organs (Supplementary Figure S1B). To study whether TCR stimulation affects CD3z interaction with EB1, anti-CD3-stimulated thymocytes and spleen T cells were immunoprecipitated with anti-CD3z. EB1 co-immunoprecipitated with the TCR in both cell lysates, independently of CD3 stimulation (Figure S1C). To further analyse whether EB1 binding to CD3z was altered by stimulation, CD3z was immunoprecipitated from primary CD8þ OT-I transgenic T cells stimulated by OVA antigen-loaded T2kb cells. The recovery of EB1 was similar with or without stimulation (Figure S1D). sf1c sf1d sf1e cd3e-ccr7 2 EBI1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cdna library cdna library fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CD3 epsilon 6 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association st1 homomint mint