UniProt UniProt http://www.uniprot.org A new crystal form of human histidine triad nucleotide-binding protein 1 (hHINT1) in complex with adenosine 5'-monophosphate at 1.38 A resolution. A new crystal form of human histidine triad nucleotide-binding protein 1 (hHINT1) in complex with adenosine 5'-monophosphate at 1.38 A resolution. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2012 imex curation Dolot R., Ozga M., Włodarczyk A., Krakowiak A., Nawrot B. rdolot@cbmm.lodz.pl 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dolot R., Ozga M., Włodarczyk A., Krakowiak A., Nawrot B. rdolot@cbmm.lodz.pl Accepted 2013-FEB-25 by ORCHARD 01-March-2013: Contacted by IntAct-Help. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2012 Only protein-protein interactions imex curation hint1_human Adenosine 5'-monophosphoramidase HINT1 Protein kinase C inhibitor 1 Protein kinase C-interacting protein 1 HINT1 HINT PKCI1 PRKCNH1 Desumoylating isopeptidase HINT1 Histidine triad nucleotide-binding protein 1 protein protein human Homo sapiens Human MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG 6C2B0119370384AA hint1 1 2 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction 1.38 A R-factor: 0.123 R-free: 0.161 Table 1