InnateDB InnateDB Tumor-infiltrating DCs suppress nucleic acid-mediated innate immune responses through interactions between the receptor TIM-3 and the alarmin HMGB1. Tumor-infiltrating DCs suppress nucleic acid-mediated innate immune responses through interactions between the receptor TIM-3 and the alarmin HMGB1. Nat. Immunol. (1529-2908) 2012 imex curation Chiba S., Baghdadi M., Akiba H., Yoshiyama H., Kinoshita I., Dosaka-Akita H., Fujioka Y., Ohba Y., Gorman J.V., Colgan J.D., Hirashima M., Uede T., Takaoka A., Yagita H., Jinushi M. TIM-3 species information inferred from amino acid mapping, HMGB1 from ref. 50, species of RAGE confirmed via correspondence jinushi@igm.hokudai.ac.jp 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity mouse-bmdc Mus musculus bone marrow-derived dendritic cells bmdm-1 bone marrow-derived macrophage confocal microscopy confocal microscopy immunostaining immunostaining Chiba S., Baghdadi M., Akiba H., Yoshiyama H., Kinoshita I., Dosaka-Akita H., Fujioka Y., Ohba Y., Gorman J.V., Colgan J.D., Hirashima M., Uede T., Takaoka A., Yagita H., Jinushi M. TIM-3 species information inferred from amino acid mapping, HMGB1 from ref. 50, species of RAGE confirmed via correspondence jinushi@igm.hokudai.ac.jp Accepted 2013-SEP-09 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2012 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Tumor-infiltrating DCs suppress nucleic acid-mediated innate immune responses through interactions between the receptor TIM-3 and the alarmin HMGB1. Tumor-infiltrating DCs suppress nucleic acid-mediated innate immune responses through interactions between the receptor TIM-3 and the alarmin HMGB1. Nat. Immunol. (1529-2908) 2012 imex curation Chiba S., Baghdadi M., Akiba H., Yoshiyama H., Kinoshita I., Dosaka-Akita H., Fujioka Y., Ohba Y., Gorman J.V., Colgan J.D., Hirashima M., Uede T., Takaoka A., Yagita H., Jinushi M. TIM-3 species information inferred from amino acid mapping, HMGB1 from ref. 50, species of RAGE confirmed via correspondence jinushi@igm.hokudai.ac.jp 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chiba S., Baghdadi M., Akiba H., Yoshiyama H., Kinoshita I., Dosaka-Akita H., Fujioka Y., Ohba Y., Gorman J.V., Colgan J.D., Hirashima M., Uede T., Takaoka A., Yagita H., Jinushi M. TIM-3 species information inferred from amino acid mapping, HMGB1 from ref. 50, species of RAGE confirmed via correspondence jinushi@igm.hokudai.ac.jp Accepted 2013-SEP-09 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2012 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Tumor-infiltrating DCs suppress nucleic acid-mediated innate immune responses through interactions between the receptor TIM-3 and the alarmin HMGB1. Tumor-infiltrating DCs suppress nucleic acid-mediated innate immune responses through interactions between the receptor TIM-3 and the alarmin HMGB1. Nat. Immunol. (1529-2908) 2012 imex curation Chiba S., Baghdadi M., Akiba H., Yoshiyama H., Kinoshita I., Dosaka-Akita H., Fujioka Y., Ohba Y., Gorman J.V., Colgan J.D., Hirashima M., Uede T., Takaoka A., Yagita H., Jinushi M. TIM-3 species information inferred from amino acid mapping, HMGB1 from ref. 50, species of RAGE confirmed via correspondence jinushi@igm.hokudai.ac.jp 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined Chiba S., Baghdadi M., Akiba H., Yoshiyama H., Kinoshita I., Dosaka-Akita H., Fujioka Y., Ohba Y., Gorman J.V., Colgan J.D., Hirashima M., Uede T., Takaoka A., Yagita H., Jinushi M. TIM-3 species information inferred from amino acid mapping, HMGB1 from ref. 50, species of RAGE confirmed via correspondence jinushi@igm.hokudai.ac.jp Accepted 2013-SEP-09 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2012 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity rage_mouse Advanced glycosylation end product-specific receptor Ager Rage Receptor for advanced glycosylation end products protein protein mouse Mus musculus Mouse MPAGTAARAWVLVLALWGAVAGGQNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLNTAPIQLRVREPGPPEGIQLLVEPEGGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLPEVGHEDEGTYSCVATHPSHGPQESPPVSIRVTETGDEGPAEGSVGESGLGTLALALGILGGLGVVALLVGAILWRKRQPRREERKAPESQEDEEERAELNQSEEAEMPENGAGGP DBFDC50A6C8CB902 havr2_mouse Hepatitis A virus cellular receptor 2 homolog Havcr2 Tim3 Timd3 T-cell immunoglobulin and mucin domain-containing protein 3 T-cell membrane protein 3 T-cell immunoglobulin mucin receptor 3 protein protein mouse Mus musculus Mouse MFSGLTLNCVLLLLQLLLARSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIRTAIHIGVGVSAGLTLALIIGVLILKWYSCKKKKLSSLSLITLANLPPGGLANAGAVRIRSEENIYTIEENVYEVENSNEYYCYVNSQQPS DIP protein Q8VIM0 original sequence version: 99 C0349E4BD0E5761D hmgb1_mouse High mobility group protein B1 Hmgb1 Hmg-1 Hmg1 High mobility group protein 1 protein protein mouse Mus musculus Mouse MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE 8A868DE266D552B5 ager-hmgb1 3 4 unspecified role unspecified role prey prey region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig. 6A hmgb1-havcr2 3 6 unspecified role unspecified role bait bait P63158:p.Asp62Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A Wed May 02 19:27:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp62ala' Tue Jun 30 18:40:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp62Ala' region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig. 6A, 6B, 6D, S5A. havcr2-hmgb1 3 5 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind range range range range direct interaction direct interaction Fig. S5D. havcr2-hmgb1-1 1 6 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 6E, 7D EEA1 used as an endosomal marker havcr2-hmgb1-2 2 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6F