IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ An interaction map of endoplasmic reticulum chaperones and foldases. An interaction map of endoplasmic reticulum chaperones and foldases. Mol. Cell Proteomics (1535-9476) 2012 imex curation Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! ref 6 gives (non- uniprot) IgG1 chains from murine monoclonal ab MAK33, however the sequences given in this paper, pdbe (entry 1FH5), and ref 6 do not appear to be using the same sequence numbering (and pdb says it is human!) Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro oxidoreduct assay oxidoreductase assay oxidoreduct assay predetermined predetermined participant predetermined Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca Accepted 2013-NOV-21 by PPORRAS Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation An interaction map of endoplasmic reticulum chaperones and foldases. An interaction map of endoplasmic reticulum chaperones and foldases. Mol. Cell Proteomics (1535-9476) 2012 imex curation Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! ref 6 gives (non- uniprot) IgG1 chains from murine monoclonal ab MAK33, however the sequences given in this paper, pdbe (entry 1FH5), and ref 6 do not appear to be using the same sequence numbering (and pdb says it is human!) Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! You CAN check this now - jet lagged author replied very promptly! Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca Accepted 2013-NOV-21 by PPORRAS Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation An interaction map of endoplasmic reticulum chaperones and foldases. An interaction map of endoplasmic reticulum chaperones and foldases. Mol. Cell Proteomics (1535-9476) 2012 imex curation Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! ref 6 gives (non- uniprot) IgG1 chains from murine monoclonal ab MAK33, however the sequences given in this paper, pdbe (entry 1FH5), and ref 6 do not appear to be using the same sequence numbering (and pdb says it is human!) Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast transcription compl transcriptional complementation assay transcription compl predetermined predetermined participant predetermined Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! You CAN check this now - jet lagged author replied very promptly! Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca Accepted 2013-NOV-21 by PPORRAS Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation An interaction map of endoplasmic reticulum chaperones and foldases. An interaction map of endoplasmic reticulum chaperones and foldases. Mol. Cell Proteomics (1535-9476) 2012 imex curation Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! ref 6 gives (non- uniprot) IgG1 chains from murine monoclonal ab MAK33, however the sequences given in this paper, pdbe (entry 1FH5), and ref 6 do not appear to be using the same sequence numbering (and pdb says it is human!) Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. crosslink cross-linking study crosslink sequence tag sequence tag identification sequence tag Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca Accepted 2013-NOV-21 by PPORRAS Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation An interaction map of endoplasmic reticulum chaperones and foldases. An interaction map of endoplasmic reticulum chaperones and foldases. Mol. Cell Proteomics (1535-9476) 2012 imex curation Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! ref 6 gives (non- uniprot) IgG1 chains from murine monoclonal ab MAK33, however the sequences given in this paper, pdbe (entry 1FH5), and ref 6 do not appear to be using the same sequence numbering (and pdb says it is human!) Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca Accepted 2013-NOV-21 by PPORRAS Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation An interaction map of endoplasmic reticulum chaperones and foldases. An interaction map of endoplasmic reticulum chaperones and foldases. Mol. Cell Proteomics (1535-9476) 2012 imex curation Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! ref 6 gives (non- uniprot) IgG1 chains from murine monoclonal ab MAK33, however the sequences given in this paper, pdbe (entry 1FH5), and ref 6 do not appear to be using the same sequence numbering (and pdb says it is human!) Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down sequence tag sequence tag identification sequence tag Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca Accepted 2013-NOV-21 by PPORRAS Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation An interaction map of endoplasmic reticulum chaperones and foldases. An interaction map of endoplasmic reticulum chaperones and foldases. Mol. Cell Proteomics (1535-9476) 2012 imex curation Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! ref 6 gives (non- uniprot) IgG1 chains from murine monoclonal ab MAK33, however the sequences given in this paper, pdbe (entry 1FH5), and ref 6 do not appear to be using the same sequence numbering (and pdb says it is human!) Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca Accepted 2013-NOV-21 by PPORRAS Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation An interaction map of endoplasmic reticulum chaperones and foldases. An interaction map of endoplasmic reticulum chaperones and foldases. Mol. Cell Proteomics (1535-9476) 2012 imex curation Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! ref 6 gives (non- uniprot) IgG1 chains from murine monoclonal ab MAK33, however the sequences given in this paper, pdbe (entry 1FH5), and ref 6 do not appear to be using the same sequence numbering (and pdb says it is human!) Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca Accepted 2013-NOV-21 by PPORRAS Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation An interaction map of endoplasmic reticulum chaperones and foldases. An interaction map of endoplasmic reticulum chaperones and foldases. Mol. Cell Proteomics (1535-9476) 2012 imex curation Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! ref 6 gives (non- uniprot) IgG1 chains from murine monoclonal ab MAK33, however the sequences given in this paper, pdbe (entry 1FH5), and ref 6 do not appear to be using the same sequence numbering (and pdb says it is human!) Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca Accepted 2013-NOV-21 by PPORRAS Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation An interaction map of endoplasmic reticulum chaperones and foldases. An interaction map of endoplasmic reticulum chaperones and foldases. Mol. Cell Proteomics (1535-9476) 2012 imex curation Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! ref 6 gives (non- uniprot) IgG1 chains from murine monoclonal ab MAK33, however the sequences given in this paper, pdbe (entry 1FH5), and ref 6 do not appear to be using the same sequence numbering (and pdb says it is human!) Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Jansen G., Määttänen P., Denisov A.Y., Scarffe L., Schade B., Balghi H., Dejgaard K., Chen L.Y., Muller W.J., Gehring K., Thomas D.Y. You CAN check this now - jet lagged author replied very promptly! Purified recombinant bait proteins were coupled to NHS-activated Sepharose 4B beads, and interacting proteins were captured from rat liver low density microsomes prepared from smooth ER. Figure 4 (also Supp. Fig 8) "Assembly of the immunoglobulin G CH1-CL heterodimer in vitro." has not been curated as it has not been possible to establish the correct sequences of the immunoglobulin chains used, as given in Ref 6 (Supplement). gregor.jansen@mcgill.ca,pekka.maattanen@usask.ca Accepted 2013-NOV-21 by PPORRAS Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation calx_human Calnexin CANX Major histocompatibility complex class I antigen-binding protein p88 p90 IP90 protein protein human Homo sapiens Human MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE DIP protein P27824 original sequence version: 177 EDE094D9B82261EE q5u2v1_rat Peptidylprolyl isomerase Fkbp10 LOC360627 rCG_35007 protein protein rat Rattus norvegicus (Rat) Rat MFLVGAPSHTLPRLHILPLLLLLQTLERGLGRASPSGAPLEDVVIERYHIPRACPREVQMGDFVRYHYNGTFEDGKKFDSSYDRSTLVAIIVGVGRLITGMDRGLMGMCVNERRRLIIPPHLGYGSIGLAGLIPPDATLYFDVVLLDVWNKEDTVQSTILLRPPYCPRMVRNSDFVRYHYNGTLLDGTAFDSSYSRGGTYDTYIGSGWLIKGMDQGLLGMCPGEKRKIIIPPFLAYGEKGYGTVIPPQASLVFYVLLIDVHNPKDTVQLETLELPQDCVRRAVAGDFMRYHYNGSLMDGTLFDSSYSRNHTYNTYVGQGYIIPGMDQGLQGACIGERRRITVPPHLAYGENGTGDKIPGSAVLIFDVHVIDFHNPADPVEIKTLFRPPESCNETAKIGDFIRYHYNCSLLDGTRLFSSHDYEAPQEITLGANKVIEGLDRGLQGMCVGERRQLIVPPHLAHGENGARGVPGSAVLLFEVELISREDGLPAGYLFVWYQDPPASLFEDMDLNKDGEVPPEEFSSFIKAQVNEGKGRLMPGQDPDKTISDMFQNQDRNQDGKITAEELKLKSDEDQERIHEEL DE0DC22C3C1B6DB3 fkbp9_rat Peptidyl-prolyl cis-trans isomerase FKBP9 Fkbp9 FK506-binding protein 9 Rotamase protein protein rat Rattus norvegicus (Rat) Rat MAFGARGWRRWSLLLLLLWVTGQAAPVLGLAVSSELQIQRSFVPDECPRTVRSGDFVRYHYVGTFLDGQKFDSSYDRDSTFSVFVGKGQLIAGMDQALVGMCVNERRFVTIPPNLAYGSEGVSGVIPPNSVLHFDVLLVDIWNSEDQVQIQTYFKPPSCPRTIQVSDFVRYHYNGTFLDGTLFDSSHNRMKTYDTYVGIGWLIPGMDKGLLGMCVGEKRIITIPPFLAYGEEGDGKDIPGQASLVFDVALLDLHNPKDTISVENKVVPESCERRSQSGDFLRYHYNGTLLDGTLFDSSYSRNHTFDTYIGQGYVIPGMDEGLLGVCIGERRRIVVPPHLGYGEEGRGSIPGSAVLVFDIHVIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKTYNIVLGFGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELVSGLPEGYMFIWNGEVSPNLFEEIDKDGNGEVLLEEFSEYIHAQVASGKGKLAPGFNAEMIVKNMFTNQDRNGDGKVTAEEFKLKDQETKHDEL C4672322A367B310 edem2_mouse ER degradation-enhancing alpha-mannosidase-like protein 2 Edem2 protein protein mouse Mus musculus Mouse MPFRLLIPLGLVCVLLPLHHGAPGPDGTAPDPAHYRERVKAMFYHAYDSYLENAFPYDELRPLTCDGHDTWGSFSLTLIDALDTLLILGNTSEFQRVVEVLQDNVDFDIDVNASVFETNIRVVGGLLSAHLLSKKAGVEVEAGWPCSGPLLRMAEEAARKLLPAFQTPTGMPYGTVNLLHGVNPGETPVTCTAGIGTFIVEFATLSSLTGDPVFEDVARVALMRLWESRSDIGLVGNHIDVLTGKWVAQDAGIGAGVDSYFEYLVKGAILLQDKKLMAMFLEYNKAIRNYTHFDDWYLWVQMYKGTVSMPVFQSLEAYWPGLQSLIGDIDNAMRTFLNYYTVWKQFGGLPEFYNIPQGYTVEKREGYPLRPELIESAMYLYRATGDPTLLELGRDAVESIEKISKVECGFATIKDLRDHKLDNRMESFFLAETVKYLYLLFHPNNFIHNNGSTFDSVMTPHGECILGAGGYIFNTEAHPIDPAALHCCRRLKEEQWEVEDLIKEFYSLKQSRPKRAQRKTVRSGPWEPQSGPATLSSPANQPREKQPAQQRTPLLSCPSQPFTSKLALLGQVFLDSS 3B6992FE87F17ED9 pdia3_human Protein disulfide-isomerase A3 Disulfide isomerase ER-60 Endoplasmic reticulum resident protein 60 58 kDa microsomal protein Endoplasmic reticulum resident protein 57 58 kDa glucose-regulated protein PDIA3 ERP60 GRP58 ERP57 protein protein human Homo sapiens Human MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL DIP protein P30101 original sequence version: 82 529E5B6692D0D7E9 uggg1_rat UDP-glucose:glycoprotein glucosyltransferase 1 Ugcgl1 Uggt1 Gt Uggt Ugt1 Ugtr UDP-glucose ceramide glucosyltransferase-like 1 UDP--Glc:glycoprotein glucosyltransferase protein protein rat Rattus norvegicus (Rat) Rat MCSRGDANAAGAAAARRVTGLCYNMGLLIALALLCLFSLAEANSKAITTSLTTKWFSAPLLLEASEFLAEDSQEKFWSFVEASQNIGSSDQHDTDRSYYDAILEAAFRFLSPLQQNLLKFCLSLRSYSASIQAFQQIAVDEPPPEGCKSFLSVHGKQTCDLGTLESLLLTAPDRPKPLLFKGDHRYPSSNPESPVVIFYSEIGHEEFSNIHHQLISKSNEGKINYVFRHYISNPRKEPVHLSGYGVELAIKSTEYKAKDDTQVKGTEVNTTVIGENDPIDEVQGFLFGKLRELYPSLEGQLKEFRKHLVESTNEMAPLKVWQLQDLSFQTAARILAAPVELALVVMKDISQNFPTKARAITKTAVSAQLRAEVEENQKYFKGTIGLQPGDSALFINGLHIDLDTQDIFSLFDTLRNEARVMEGLHRLGIEGLSLHNILKLNIQPSETDYAVDIRSPAISWVNNLEVDSRYNSWPSSLQELLRPTFPGVIRQIRKNLHNMVFIVDPVHETTAELVSIAEMFLSNHIPLRIGFIFVVNDSEDVDGMQDAGVAVLRAYNYVGQEVDGYHAFQTLTQIYNKVRTGEKVKVEHVVSVLEKKYPYVEVNSILGIDSAYDQNRKEARGYYEQTGVGPLPVVLFNGMPFEKEQLDPDELETITMHKILETTTFFQRAVYLGELSHDQDVVEYIMNQPNVVPRINSRILTAKREYLDLTASNNFYVDDFARFSALDSRGKTAAIANSMNYLTKKGMSSKEIYDDSFIRPVTFWIVGDFDSPSGRQLLYDAIKHQKTSNNVRISMINNPSREISDSSTPVSRAIWAALQTQTSNSAKNFITKMVKEETAEALAAGVDIGEFSVGGMDVSLFKEVFESSRMDFILSHALYCRDVLKLKKGQRVVISNGRIIGPLEDSELFNQDDFHLLENIILKTSGQKIKSHIQQLRVEEDVASDLVMKVDALLSAQPKGEARIEYQFFEDKHSAIKLKPKEGETYYDVVAVVDPVTREAQRLAPLLLVLAQLINMSLRVFMNCQSKLSDMPLKSFYRYVLEPEISFTADNSFAKGPIAKFLDMPQSPLFTLNLNTPESWMVESVRTPYDLDNIYLEEVDSIVAAEYELEYLLLEGHCYDITTGQPPRGLQFTLGTSANPTTVDTIVMANLGYFQLKANPGAWILRLRKGRSDDIYRIYSHDGTDSPPDANDVVVILNNFKSKIIKVKVQKKADMANEDLLSDGTNENESGFWDSFKWGFSGQKTEEVKQDKDDIINIFSVASGHLYERFLRIMMLSVLKNTKTPVKFWFLKNYLSPTFKEFIPYMAKKYNFQYELVQYKWPRWLHQQTEKQRIIWGYKILFLDVLFPLVVDKFLFVDADQIVRTDLKELRDFNLDGAPYGYTPFCDSRREMDGYRFWKSGYWASHLAGRKYHISALYVVDLKKFRKIAAGDRLRGQYQGLSQDPNSLSNLDQDLPNNMIHQVPIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKEPKLEAAVRIVPEWQDYDQEIKQLQTLFQEEKELGTLHEEETQEGSQKHEEL FD4A1B6BCCBF7738 pdia4_rat Protein disulfide-isomerase A4 Endoplasmic reticulum resident protein 72 Calcium-binding protein 2 Pdia4 Cabp2 Erp70 Endoplasmic reticulum resident protein 70 protein protein rat Rattus norvegicus (Rat) Rat MKLRKAWLLVLLLALTQLLAAASAEDAHEDASDSENPIEDDDDEEEDEEDEDDLEVKEENGVWVLNDENFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSASMLASKFDVSGYPTIKILKKGQAVDYDGSRTQEEIVAKVREVSQPDWTPPPEVTLTLTKENFDDVVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLAKRFDVSGYPTLKIFRKGRPFDYNGPREKYGIVDYMVEQSGPPSKEILTLKQVQEFLKDGDDVVILGVFQGVGDPGYLQYQDAANTLREDYKFHHTFSTEIAKFLKVSLGKLVLMQPEKFQSKYEPRMHVMDVQGSTEASAIKDYVVKHALPLVGHRKTSNDAKRYSKRPLVVVYYSVDFSFDYRTATQFWRNKVLEVAKDFPEYTFAIADEEDYATEVKDLGLSESGEDVNAAILDESGKKFAMEPEEFDSDALQEFVMAFKKGKLKPVIKSQPVPKNNKGPVRVVVGKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPVYTSLGKKYKGQKDLVIAKMDATANDITNDRYKVEGFPTIYFAPSGDKKNPIKFEGGNRDLEHLSKFIDEHATKRSRTKEEL C5BC8536834543ED prdx4_rat Peroxiredoxin-4 Prdx4 Rno2CysPrx04 Thioredoxin-dependent peroxiredoxin 4 Peroxiredoxin IV Thioredoxin peroxidase AO372 Thioredoxin-dependent peroxide reductase A0372 Antioxidant enzyme AOE372 protein protein rat Rattus norvegicus (Rat) Rat METWSKLLDGTTPSRRWRKLVLLLPPLLLFLLQTEALQGLESDDRFRTRENECHFYAGGQVYPGEVSRVSVADHSLHLSKAKISKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRIEEFKSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDSGHTLRGLFIIDDKGVLRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 09E614794F1DC6C2 djc10_rat DnaJ homolog subfamily C member 10 Dnajc10 protein protein rat Rattus norvegicus (Rat) Rat MGVWLNRDEFIRDVKRISLCLLVLYVVIVVGTDQNFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWSYYRYDFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWREFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYNGDRSKESLVSFAMQHVRTTVTELSTGNFVNAIETAFAAGIGWLITFCFKGEDCLTPQTRLRLSGMLDGLVNVGWVDCDTQDSLCKSLDATASTTAYFPPGATLNNKEKSSVLFLNSLDAKEIYMEIIHNLPDFELLSANKLEDRLAHHRWLVFFHFGKNENANDPELKKLKTLLKNEHIQVGRFDCSSAPGICSDLYVFQSCLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPASDKEPWLVDFFAPWCPPCRALLPELRKASTLLYGQLKVGTLDCTIHEGLCNMYNIQAYPTTVVFNQSSVHEYEGHHSAEQILEFIEDLRNPSVVSLTPTTFNELVKQRKHDEVWMVDFYSPWCHPCQVLMPEWKRMARTLTGLINVGSVDCQQYHSFCTQENVQRYPEIRFYPQKSSRAYQYHSYNGWNRDAYSLRSWGLGFLPQASIDLTPQTFNEKVLQGKTHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYPQTCQKAGIRAYPSVKLYLYERAKKSIWEEQINSRDAKTIAALIYGKLETFQSQVKRNKDEL 9578A69C36C858C9 dnjb9_rat DnaJ homolog subfamily B member 9 Dnajb9 Mdg1 Microvascular endothelial differentiation gene 1 protein Endoplasmic reticulum DNA J domain-containing protein 4 protein protein rat Rattus norvegicus (Rat) Rat MATPQSVFVFAICILMITELILASKNYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDIIGHSAFTNGKGQRSNGSPFEQSFNFNFDDLFKDFNLFGQNQNTRSKKHFENHFQTRQDGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNRRTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ 08BF5347F20B65DC enpl_rat Endoplasmin Hsp90b1 Grp94 Tra1 94 kDa glucose-regulated protein Heat shock protein 90 kDa beta member 1 protein protein rat Rattus norvegicus (Rat) Rat MRVLWVLGLCCVLLTFGFVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDREKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVRKYSQFINFPIYVWSSKTETVEEPLEEDETAQEEKEEADDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDDFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKYNDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHSTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKSKESREATEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRVKEDEDDKTVMDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNIDPEAQVEEEPEEEPEDTTEDTTDDSEQDEEETDAGAEEEEEEQETEKEPTEKDEL 5C1A2DC8ED6B1CC8 tor1a_human Torsin-1A Torsin family 1 member A Dystonia 1 protein TOR1A DQ2 DYT1 TA Torsin ATPase-1A TORA protein protein human Homo sapiens Human MKLGRAVLGLLLLAPSVVQAVEPISLGLALAGVLTGYIYPRLYCLFAECCGQKRSLSREALQKDLDDNLFGQHLAKKIILNAVFGFINNPKPKKPLTLSLHGWTGTGKNFVSKIIAENIYEGGLNSDYVHLFVATLHFPHASNITLYKDQLQLWIRGNVSACARSIFIFDEMDKMHAGLIDAIKPFLDYYDLVDGVSYQKAMFIFLSNAGAERITDVALDFWRSGKQREDIKLKDIEHALSVSVFNNKNSGFWHSSLIDRNLIDYFVPFLPLEYKHLKMCIRVEMQSRGYEIDEDIVSRVAEEMTFFPKEERVFSDKGCKTVFTKLDYYYDD B69B28D0B4112080 edem1_mouse ER degradation-enhancing alpha-mannosidase-like protein 1 Edem1 Edem protein protein mouse Mus musculus Mouse MQWRALVLGLVLLRLGLHAVLWLVFGLGPSMGFYQRFPLSFGFQRLRDPDGSGPVGPPGGPAWLHRPRRGTEGRLETPPEPGPTPGPGVCGPAHWGYALGGGGCGPDEYERRYSGAFPPQLRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIYCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQPFGDMTIEDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQSYLRRGREACNEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERYNWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISVDKRLRELPWKEFFSEDGERDQEEKFVHRPKSQELRVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGLI 3BFC9A874B0E537E calr_rat Calreticulin CRP55 Calregulin HACBP Endoplasmic reticulum resident protein 60 CALBP Calcium-binding protein 3 Calr protein protein rat Rattus norvegicus (Rat) Rat MLLSVPLLLGLLGLAAADPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPGGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDEDDRDEDEDEEDEKEEDEEDATGQAKDEL 2E6713CED31A2970 fkbp7_human Peptidyl-prolyl cis-trans isomerase FKBP7 FKBP7 FKBP23 23 kDa FK506-binding protein FK506-binding protein 7 Rotamase UNQ670/PRO1304 protein protein human Homo sapiens Human MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL 362957BAD3C5C2A6 djc10_human DnaJ homolog subfamily C member 10 DNAJC10 ERDJ5 Macrothioredoxin UNQ495/PRO1012 Endoplasmic reticulum DNA J domain-containing protein 5 protein protein human Homo sapiens Human MGVWLNKDDYIRDLKRIILCFLIVYMAILVGTDQDFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWNYYRYDFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSFAMQHVRSTVTELWTGNFVNSIQTAFAAGIGWLITFCSKGGDCLTSQTRLRLSGMLDGLVNVGWMDCATQDNLCKSLDITTSTTAYFPPGATLNNKEKNSILFLNSLDAKEIYLEVIHNLPDFELLSANTLEDRLAHHRWLLFFHFGKNENSNDPELKKLKTLLKNDHIQVGRFDCSSAPDICSNLYVFQPSLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPANDKEPWLVDFFAPWCPPCRALLPELRRASNLLYGQLKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFIEDLMNPSVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKRMARTLTGLINVGSIDCQQYHSFCAQENVQRYPEIRFFPPKSNKAYHYHSYNGWNRDAYSLRIWGLGFLPQVSTDLTPQTFSEKVLQGKNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLETLRNQGKRNKDEL DIP protein Q8IXB1 original sequence version: 65 BD39B64325432D5D djb11_rat DnaJ homolog subfamily B member 11 Dnajb11 ER-associated Hsp40 co-chaperone ER-associated DNAJ Liver regeneration-related protein LRRGT00084 Endoplasmic reticulum DNA J domain-containing protein 3 protein protein rat Rattus norvegicus (Rat) Rat MAPQNLSTFCLLLLYLIGAVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGAPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHRIFERRGDDLYTNVTVSLVEALVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAKEGIKQLLKQGPVQKVYNGLQGY 25BBB32B17460C67 pdia6_rat Protein disulfide-isomerase A6 Pdia6 Cabp1 Txndc7 Protein disulfide isomerase P5 Calcium-binding protein 1 Thioredoxin domain-containing protein 7 protein protein rat Rattus norvegicus (Rat) Rat MARLVLGLVSCTFFLAVSALYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAASALKDVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKKTCEEHQLCVVAVLPHILDTGATGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGSFPNITPREPWDGKDGELPVEDDIDLSDVELDDLEKDEL 8D388E4FFD743719 calr_human Calreticulin CRP55 Calregulin HACBP Endoplasmic reticulum resident protein 60 grp60 CALR CRTC protein protein human Homo sapiens Human MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL BC37C3C0F1054FB2 calx_rat Calnexin Canx protein protein rat Rattus norvegicus (Rat) Rat MEGKWLLCLLLVLGTAAIQAHDGHDDDMIDIEDDLDDVIEEVEDSKSKSDTSTPPSPKVTYKAPVPTGEVYFADSFDRGSLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTSELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAVKPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVGQMLEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQSNAMEYKKTDAPQPDVKDEEGKEEEKNKGDEEEEEEKLEEKQKSDAEEDGGTGSQDEEDSKPKAEEDEILNRSPRNRKPRRE DF91D099593C62B2 txd12_mouse Thioredoxin domain-containing protein 12 Txndc12 Tlp19 Thioredoxin-like protein p19 Endoplasmic reticulum resident protein 19 protein protein mouse Mus musculus Mouse MSLRFGATCLLSFSFLLLITSSDGRTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL Possesses significant protein thiol-disulfide oxidase activity mint 5B91FC9BE12C5E44 p07237-pro_0000034195 Protein disulfide-isomerase P4HB ERBA2L PDI PDIA1 PO4DB Cellular thyroid hormone-binding protein Prolyl 4-hydroxylase subunit beta p55 protein protein human Homo sapiens Human DAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQKAVKDEL 18 508 BD5373FB123AEA33 dnjc3_rat DnaJ homolog subfamily C member 3 Dnajc3 P58ipk Interferon-induced, double-stranded RNA-activated protein kinase inhibitor Protein kinase inhibitor of 58 kDa protein protein rat Rattus norvegicus (Rat) Rat MVAPGSVRSRLGAVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTRVIELKMDFTAARLQRGHLLLKQGRLAEAEDDFKKVLKSNPSENEEKEAQSQLVKADEMQRLRAQALDAFDSADYTAAITFLDEILEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKNDNTEAFYKISILYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIGSAEELIRDGRYTDATSKYESVMKAEPSVAEYTVRSKERICHCFSKDEKPVEAIKICSEVLQLEPDNVNALKDRAEAYLIEEMYDEAIQDYEAAQEQNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQWHPDNFQSEEEKKKAEKKFIDIAAAKEVLSDPEMRRKFDDGEDPLDAETQQGGGSNPFHRSWDSWQGFNPFSSGGPFRFKFHFN 1268B6A7771163DD glutathione disulfid glutathione disulfide Glutathione disulfide glutathione disulphide GSSG oxidised glutathione Oxidized glutathione OXIDIZED GLUTATHIONE DISULFIDE Oxiglutatione (2S,2'S)-5,5'-[disulfanediylbis({(2R)-3-[(carboxymethyl)amino]-3-oxopropane-1,2-diyl}imino)]bis(2-amino-5-oxopentanoic acid) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) YPZRWBKMTBYPTK-BJDJZHNGSA-N YPZRWBKMTBYPTK-BJDJZHNGSA-N pdia4_human Protein disulfide-isomerase A4 Endoplasmic reticulum resident protein 72 PDIA4 ERP70 ERP72 Endoplasmic reticulum resident protein 70 protein protein human Homo sapiens Human MRPRKAFLLLLLLGLVQLLAVAGAEGPDEDSSNRENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFLKDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLKVSQGQLVVMQPEKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGHRKVSNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSESGEDVNAAILDESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGFPTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEHATKLSRTKEEL 1919C2AE12CD2684 ppib_rat Peptidyl-prolyl cis-trans isomerase B Cyclophilin B S-cyclophilin CYP-S1 Ppib Rotamase B protein protein rat Rattus norvegicus (Rat) Rat MLRLSERNMKVLFAAALIVGSVVFLLLPGPSVANDKKKGPKVTVKVYFDFQIGDEPVGRVTFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKVENTKTDSRDKPLKDVIIVDCGKIEVEKPFAIAKE 8750D541754380D5 q9vvj7_drome Sep15 BcDNA:SD16138 Dmel\CG7484 Prise 8 CG7484 Dmel_CG7484 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MHKCAIFLLLALSCQQIQAELTAADCRALGFIKAQLMCSSCEKLDDFGLDTIKPQCKQCCTLDQQPAAQRTYAKAILEVCTCKFRAYPQIQAFIQSGRPAKFPNLQIKYVRGLDPVVKLLDASGKVQETLSITKWNTDTVEEFFETHLAKDGAGKNSYSVVEDADGDDDEDYLRTNRI 7BBD70BEAE47D76D edem3_mouse ER degradation-enhancing alpha-mannosidase-like protein 3 Edem3 Alpha-1,2-mannosidase EDEM3 protein protein mouse Mus musculus Mouse MSKAGGCRGCGCRVPQRASWSLVAATAALCLVLATSVCTAGAAPMSREEKQKLGNQVLEMFDHAYGNYMEHAYPADELMPLTCRGRVRGQEPSRGDVDDALGKFSLTLIDSLDTLVVLNKTKEFEDAVRKVLRDVNLDNDVVVSVFETNIRVLGGLLGGHSLAIMLKEKGEHMQWYNDELLHMAKQLGYKLLPAFNTTSGLPYPRINLKFGIRKPEARTGTETDTCTACAGTLILEFAALSRFTGATIFEEYARKALDFLWEKRQRSSNLVGVTINIHTGDWVRKDSGVGAGIDSYYEYLLKAYVLLGDDSFLERFNTHYDAIMRYISQPPLLLDVHIHKPMLNARTWMDALLAFFPGLQVLKGDIRPAIETHEMLYQVIKKHNFLPEAFTTDFRVHWAQHPLRPEFAESTYFLYKATGDPYYLEVGKTLIENLNKYARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLYLLFADKEDIIFDIEDYIFTTEAHLLPLWLSTTNRSISKKNTTSEYTELDDSNFDWTCPNTQILFPNDPLYAQSIREPLKNVVDKSCPRGIIRVEESFRSGAKPPLRARDFMATNPEHLEILKKMGVSLIHLKDGRVQLVQHAIQAASSIDAEDGLRFMQEMIELSSQQQKEQQLPPRAVQIISHPFFGRVVLTAGPAQFGLDLSKHKETRGFVASSKPYNGCSELTNPEAVMGKIALIQRGQCMFAEKARNIQNAGAIGGIVIDDNEGSSSDTAPLFQMAGDGKDTDDIKIPMLFLFSKEGSIILDAIREHEQVEVLLSDKARDRDPEMENEDQPSSENDSQNQSAEQMLSLSQTVDLADKESPEHPADSHSEASPSDSEEAAGFAPSEQISGSTENHETTSLDGECTDLDNQVQEQSETEEDSSPNVSWGTKAQPIDSILADWNEDIEAFEMMEKDEL 4F010D17E84E542C bip_mouse Endoplasmic reticulum chaperone BiP Immunoglobulin heavy chain-binding protein Hspa5 Grp78 78 kDa glucose-regulated protein Binding-immunoglobulin protein Heat shock protein 70 family protein 5 Heat shock protein family A member 5 protein protein mouse Mus musculus Mouse MMKFTVVAAALLLLGAVRAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSGGPPPTGEEDTSEKDEL DIP protein P20029 original sequence version: 154 DIP protein P20029 original sequence version: 113 DIP protein P20029 original sequence version: 112 DIP protein P20029 original sequence version: 117 DIP protein P20029 original sequence version: 165 AFB795D15E20FAC2 fkbp2_human Peptidyl-prolyl cis-trans isomerase FKBP2 FK506-binding protein 2 Rotamase Immunophilin FKBP13 FKBP2 FKBP13 13 kDa FK506-binding protein protein protein human Homo sapiens Human MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL 01024F869BA7B5DA pdia3_rat Protein disulfide-isomerase A3 Disulfide isomerase ER-60 Endoplasmic reticulum resident protein 60 58 kDa microsomal protein Endoplasmic reticulum resident protein 57 58 kDa glucose-regulated protein HIP-70 Q-2 Pdia3 Erp60 Grp58 protein protein rat Rattus norvegicus (Rat) Rat MRFSCLALLPGVALLLASALLASASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEDEFKKFISDKDASVVGFFRDLFSDGHSEFLKAASNLRDNYRFAHTNVESLVKEYDDNGEGITIFRPLHLANKFEDKIVAYTEKKMTSGKIKKFIQESIFGLCPHMTEDNKDLIQGKDLLTAYYDVDYEKNTKGSNYWRNRVMMVAKTFLDAGHKLNFAVASRKTFSHELSDFGLESTTGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQEYFDGNLKRYLKSEPIPETNEGPVKVVVAESFDDIVNAEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDFISYLQREATNPPIIQEEKPKKKKKAQEDL EAC7F0C0BD4F1471 sil1_rat Nucleotide exchange factor SIL1 Sil1 protein protein rat Rattus norvegicus (Rat) Rat MAPQHLPSTRMAPQGMLLGLLLASCLTFCLSCQNSNNFALTNPEKSTHEDSDTKETRREEELDAEVLEVLNPTQEWQALQPGQAVPAGSHVRMNLQTGVNEVKLQQEDKFQSNWKGFKRGRRLDINTNTYTSQDLKSALAKFKEGTEMENSKDELARQATVKQLFRPIEELKKEFDELNVVLETDMQIMVRLINKFNSSSSSLEEKVAALFDLEYYVHQMDNAQDLLSFGGLQVVINGLNSTEPLVKEYAAFVLGAAFSSNPKVQVEAIEGGALQKLLVILATEQPLPAKKKVLFALCSLLRHFPYAQQQFLKLGGLQVLRSLVQEKSAKVLAVRVVTLLYDLVTEKMFAEEEAELTQESSPEKLQQYRQVQLLPGLREQGWCEITAQLLALPEHDAREKVLQTLGALLATCRDRYRQDLELSRTLGSLQAEYQALASLELQEGEDDGYFRELLASIDSLVKELR 5645924C08F6A8FF txnd5_human Thioredoxin domain-containing protein 5 TXNDC5 TLP46 Thioredoxin-like protein p46 Endoplasmic reticulum resident protein 46 UNQ364/PRO700 protein protein human Homo sapiens Human MPARPGRLLPLLARPAALTALLLLLLGHGGGGRWGARAQEAAAAAADGPPAADGEDGQDPHSKHLYTADMFTHGIQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQAKDEL 85E398008D6DB98C erp29_rat Endoplasmic reticulum resident protein 29 Endoplasmic reticulum resident protein 31 Erp29 protein protein rat Rattus norvegicus (Rat) Rat MAAAVPGAVSLSPLLSVLLGLLLLSAPHGASGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYSGAVKVGAIQRWLKGQGVYLGMPGCLPAYDALAGQFIEASSREARQAILKQGQDGLSGVKETDKKWASQYLKIMGKILDQGEDFPASELARISKLIENKMSEGKKEELQRSLNILTAFRKKGAEKEEL 8D9EBAA756ED6CA2 hyou1_rat Hypoxia up-regulated protein 1 Hyou1 Orp150 150 kDa oxygen-regulated protein protein protein rat Rattus norvegicus (Rat) Rat MAATVRRQRPRRLLCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVTVTLKENERFLGDSAAGMAIKNPKATLRYFQHLLGKQADNPHVALYRSRFPEHELNVDPQRQTVRFQISPQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPAFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINSTAQNIMFYDMGSGSTVCTIVTYQTVKTKEAGTQPQLQIRGVGFDRTLGGLEMELRLREHLAKLFNEQRKGQKAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFDRVPGPVQQALQSAEMSLDQIEQVILVGGPTRVPKVQEVLLKPVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFVVRDAVIYPILVEFTREVEEEPGLRSLKHNKRVLFSRMGPYPQRKVITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGESFKKYPDYESKGIKAHFNLDESGVLSLDRVESVFETLVEDSPEEESTLTKLGNTISSLFGGGTSSDAKENGTDAVQEEEESPAEGSKDEPAEQGELKEEAEAPMEDTSQPPPSEPKGDAAREGETPDEKESGDKSEAQKPNEKGQAGPEGVPPAPEEEKKQKPARKQKMVEEIGVELAVLDLPDLPEDELAHSVQKLEDLTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSATSTWLEDEGFGATTVMLKDKLAELRKLCQGLFFRVEERRKWPERLSALDNLLNHSSIFLKGARLIPEMDQIFTDVEMTTLEKVINDTWTWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDREVQYLLNKAKFTKPRPRPKDKNGTRTEPPLNASAGDQEEKVIPPTGQTEEAKAILEPDKEGLGTEAADSEPLELGGPGAESEQAEQTAGQKRPLKNDEL F93D53169C5A5EBD ppib_human Peptidyl-prolyl cis-trans isomerase B PPIB CYPB Cyclophilin B S-cyclophilin CYP-S1 Rotamase B protein protein human Homo sapiens Human MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE 2D0410A07AA9E420 rnas1_bovin Ribonuclease pancreatic RNASE1 RNS1 RNase 1 RNase A protein protein bovin Bos taurus (Bovine) Bovine MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV DIP protein P61823 original sequence version: 104 74E5DC61E679187D pdia6_human Protein disulfide-isomerase A6 PDIA6 TXNDC7 Protein disulfide isomerase P5 Thioredoxin domain-containing protein 7 ERP5 P5 Endoplasmic reticulum protein 5 protein protein human Homo sapiens Human MALLVLGLVSCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDDLGKDEL 06895409F0265D7C p30040-pro_0000021197 Endoplasmic reticulum resident protein 29 ERP29 C12orf8 ERP28 Endoplasmic reticulum resident protein 28 Endoplasmic reticulum resident protein 31 protein protein human Homo sapiens Human LHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL 33 261 3EB0494ECD020163 pdia1_human Protein disulfide-isomerase P4HB PDI PDIA1 PO4DB Prolyl 4-hydroxylase subunit beta Cellular thyroid hormone-binding protein p55 ERBA2L protein protein human Homo sapiens Human MLRRALLCLAVAALVRADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQKAVKDEL DIP protein P07237 original sequence version: 198 906CE6D9900B8FCE p23284-pro_0000025479 Peptidyl-prolyl cis-trans isomerase B PPIB CYPB CYP-S1 Cyclophilin B Rotamase B S-cyclophilin protein protein human Homo sapiens Human DEKKKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE 34 216 EB04C589E3C328BE bip_rat Endoplasmic reticulum chaperone BiP Hspa5 Grp78 Immunoglobulin heavy chain-binding protein Steroidogenesis-activator polypeptide 78 kDa glucose-regulated protein Binding-immunoglobulin protein Heat shock protein 70 family protein 5 Heat shock protein family A member 5 protein protein rat Rattus norvegicus (Rat) Rat MKFTVVAAALLLLCAVRAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSPEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSGGPPPTGEEDTSEKDEL 9D686C6484150108 enpl_human Endoplasmin HSP90B1 TRA1 Heat shock protein 90 kDa beta member 1 94 kDa glucose-regulated protein GRP94 gp96 homolog Tumor rejection antigen 1 protein protein human Homo sapiens Human MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAKEEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDDFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKYNDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETAEDTTEDTEQDEDEEMDVGTDEEEETAKESTAEKDEL DIP protein P14625 original sequence version: 187 DIP protein P14625 original sequence version: 141 9BF6705A7A2ED0D0 pdia5_human Protein disulfide-isomerase A5 Protein disulfide isomerase-related protein PDIA5 PDIR protein protein human Homo sapiens Human MARAGPAWLLLAIWVVLPSWLSSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMFHAPWCGHCKKMKPEFEKAAEALHGEADSSGVLAAVDATVNKALAERFHISEFPTLKYFKNGEKYAVPVLRTKKKFLEWMQNPEAPPPPEPTWEEQQTSVLHLVGDNFRETLKKKKHTLVMFYAPWCPHCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQQEAVKGYPTFHYYHYGKFAEKYDSDRTELGFTNYIRALREGDHERLGKKKEEL 6083FBEB8C019658 hspa5-dnajc3-2 6 39 unspecified role unspecified role bait bait c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 33 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 21 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 45 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 28 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver association association Supp Table 2,4, Fig 1.-1 pdia5-calr-3 6 21 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 52 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 28 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 41 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 24 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 54 unspecified role unspecified role bait bait thioredoxin_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver association association Supp Table 2,4.-2 pdia5-calr-1 6 32 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 36 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver physical association physical association Supp Table 2,4.-3 p4hb-ppib 6 44 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 49 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association Supp Table 2,.Supp Fig 3. pdia4-ppib 6 36 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 17 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver association association Supp Table 2,4.-5 Table S2 gives ERp72 as a Human protein (P13667) yet the Experimental Proceedures states it is a RAT protein, amino acids E25-T639. As the Human protein has an "S" at position 639 - ERp72 has been entered as the RAT protein. (The authors confirm that this is the RAT protein.) pdia4-ppib-1 6 41 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 40 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Supp Table 2,4.-6 fkbp2-pdia3-1 6 24 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Supp Table 2,4, Fig 1.-8 ppib-calr 6 21 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 30 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 24 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 17 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 51 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 52 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 28 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver association association Supp Table 2,4, Fig 1.-7 CypB is stated to be D33-E216, yet the Human protein has no "D" at residue 33, only at residue 34. The authors confirm that the construct used was D34-E216 which corresponds to Feature ID PRO_0000025479 (mature protein). ppib-calr-1 2 17 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 52 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 21 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 24 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 51 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) association association Fig 1B, table S4 CypB is stated to be D33-E216, yet the Human protein has no "D" at residue 33, only at residue 34. The authors confirm that the construct used was D34-E216. pdia4-ppib-2 2 17 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 36 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver physical association physical association Fig 1B, table S4 Table S2 gives ERp72 as a Human protein (P13667) yet the Experimental Proceedures states it is a RAT protein, amino acids E25-T639. As the Human protein has an "S" at position 639 - ERp72 has been entered as the RAT protein. The authors confirm the RAT protein was used. hspa5-dnajc3-3 2 21 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 45 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 39 unspecified role unspecified role bait bait c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) association association Fig 1B, table S4 fkbp2-pdia3-2 2 24 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig 1B, table S4 pdia5-calr-4 2 21 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 24 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 17 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 54 unspecified role unspecified role bait bait thioredoxin_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 52 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver association association table S4, Supp fig2. p4hb-ppib-1 2 44 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 49 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association Fig 1B. q9vvj7-pdia4 2 17 unspecified role unspecified role prey prey 37 unspecified role unspecified role bait bait physical association physical association 1B hspa5-sil1 3 52 unspecified role unspecified role bait bait 42 unspecified role unspecified role prey prey physical association physical association Supp Table 4, Supp Table S1, Figure 1C.-2 hspa5-sil1-1 3 52 unspecified role unspecified role prey prey 52 unspecified role unspecified role bait bait physical association physical association Supp Table 4, Supp Table S1, Figure 1C.-1 hspa5-sil1-2 3 27 unspecified role unspecified role prey prey 52 unspecified role unspecified role bait bait physical association physical association Supp Table 4, Supp Table S1, -3 hspa5-dnajb11-1 3 52 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association Supp Table 4, Supp Table S1, -4 hspa5-dnajc10 3 37 unspecified role unspecified role prey prey 52 unspecified role unspecified role bait bait physical association physical association Supp Table 4, Supp Table S1, Fig 1C -5 dnajb11-dnajb11 3 27 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait physical association physical association Supp Table 4, Supp Table S1, -6 dnajb11-dnajb11-1 3 27 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association Supp Table 4, Supp Table S1, -7 dnajb11-dnajb9 3 27 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association Supp Table 4, Supp Table S1, -8 dnajb11-dnajc10 3 13 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait physical association physical association Supp Table 4, Supp Table S1, -9 dnajb11-fkbp9 3 27 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey physical association physical association Supp Table 4, Supp Table S1, -10 dnajb11-hsp90b1 3 27 unspecified role unspecified role bait bait 48 unspecified role unspecified role prey prey physical association physical association Supp Table 4, Supp Table S1, -11 dnajb11-pdia6 3 27 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey physical association physical association Supp Table 4, Supp Table S1, -12 dnajb11-tor1a 3 27 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association Supp Table 4, Supp Table S1, -13 dnajb9-dnajb11 3 20 unspecified role unspecified role bait bait 30 unspecified role unspecified role prey prey luminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Supp Table 4, Supp Table S1, -14 dnajb9-canx 3 19 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Supp Table 4, Supp Table S1, -15 dnajb9-dnajc10 3 20 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association Supp Table 4, Supp Table S1, -16 dnajb9-fkbp9 3 20 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey physical association physical association Supp Table 4, Supp Table S1, -17 dnajb9-hsp90b1 3 20 unspecified role unspecified role bait bait 48 unspecified role unspecified role prey prey physical association physical association Supp Table 4, Supp Table S1, -18 dnajc10-dnajb11 3 19 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait physical association physical association Supp Table 4, Supp Table S1, -19 dnajc10-dnajc10 3 45 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait physical association physical association Supp Table 4, Supp Table S1, -20 dnajc10-hyou1 3 48 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait physical association physical association Supp Table 4, Supp Table S1, -21 dnajc10-pdia6 3 31 unspecified role unspecified role bait bait 52 unspecified role unspecified role prey prey physical association physical association Supp Table 4, Supp Table S1, -22 txndc12-hspa5 3 31 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Supp Table 4, Supp Table S1, -23 txndc12-fkbp10 3 44 unspecified role unspecified role bait bait 52 unspecified role unspecified role prey prey physical association physical association Supp Table 4, Supp Table S1, -24 erp29-hspa5 3 25 unspecified role unspecified role prey prey 44 unspecified role unspecified role bait bait physical association physical association Supp Table 4, Supp Table S1, -25 dnajb9-canx-1 3 30 unspecified role unspecified role prey prey luminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 41 unspecified role unspecified role bait bait physical association physical association Supp Table 4, Supp Table S1, -26 pdia3-canx 3 17 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association Supp Table 4, Supp Table S1, -27 pdia4-pdia4 3 52 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait physical association physical association Supp Table 4, Supp Table S1, -28 fkbp7-hspa5 3 25 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey physical association physical association Supp Table 4, Supp Table S1, -29 fkbp7-fkbp7 3 21 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey physical association physical association Supp Table 4, Supp Table S1, -30 q9vvj7-hspa5 3 16 unspecified role unspecified role prey prey 37 unspecified role unspecified role bait bait physical association physical association Supp Table 4, Supp Table S1, Fig 1C -31 erp29-fkbp7 3 44 unspecified role unspecified role bait bait 44 unspecified role unspecified role prey prey physical association physical association Supp Table 4, Supp Table S1, -32 q9vvj7-uggt1 3 37 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association Supp Table 4, Supp Table S1, Fig 1C -33 edem1-calr 4 11 unspecified role unspecified role prey prey 50 unspecified role unspecified role prey prey 53 unspecified role unspecified role prey prey 48 unspecified role unspecified role prey prey 35 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Supp Table 4, Supp Table 3. edem2-calr-1 4 29 unspecified role unspecified role prey prey 43 unspecified role unspecified role prey prey 48 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 53 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 35 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Supp Table 4, Supp Table 3.-2 edem2-calr-2 4 48 unspecified role unspecified role prey prey 35 unspecified role unspecified role prey prey 43 unspecified role unspecified role prey prey 53 unspecified role unspecified role prey prey 38 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 15 unspecified role unspecified role prey prey association association Supp Table 4, Supp Table 3.-3 edem3-pdia3-1 10 15 unspecified role unspecified role prey prey 38 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 43 unspecified role unspecified role prey prey association association Supp Fig 4B edem1-txndc5 7 23 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 26 unspecified role unspecified role prey prey physical association physical association Supp Fig 4 edem2-txndc5 7 26 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supp Fig 4 edem3-txndc5 7 26 unspecified role unspecified role prey prey 38 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supp Fig 4 pdia4-ppib-4 9 51 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 35 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range acidic_n_term_region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction fig 3A ppib-pdia4 9 51 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 35 unspecified role unspecified role prey prey a0_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction fig 3A-2 pdia4-ppib-5 8 35 unspecified role unspecified role neutral component neutral component a0_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 51 unspecified role unspecified role neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction fig 3C pdia4-ppib-7 5 35 unspecified role unspecified role neutral component neutral component acidic_n_term_region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 46 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction fig 5A, Supp fig 7. pdia4-ppib-8 5 53 unspecified role unspecified role neutral component neutral component c_term_region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 46 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction fig 5A-2 ppib-calr-2 2 51 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P23284-PRO_0000025479:p.[Lys5Ala;Lys34Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain K A Wed May 02 17:41:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys5ala,lys34ala' Tue Jun 30 17:10:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys5Ala;Lys34Ala]' ecoli Escherichia coli (strain K12) 21 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 24 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 17 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver association association 5C CypB is stated to be D33-E216, yet the Human protein has no "D" at residue 33, only at residue 34. The authors confirm that the construct used was D34-E216. pdia4-rnase1 1 47 enzyme target enzyme target substrate substrate unspecified role unspecified role bovin-pancreas Bovine pancreas pancreas 17 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) redox reaction oxidoreductase activity electron transfer reaction redox reaction Supp 8C pdia4-rnase1-1 1 47 enzyme target enzyme target substrate substrate unspecified role unspecified role bovin-pancreas Bovine pancreas pancreas 32 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) redox reaction oxidoreductase activity electron transfer reaction redox reaction Supp 8C-2 pdia4-rnase1-2 1 17 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) 34 enzyme target enzyme target substrate substrate unspecified role unspecified role di-eosin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) redox reaction oxidoreductase activity electron transfer reaction redox reaction Supp 8D