UniProt UniProt http://www.uniprot.org Mutations in the PCNA-binding domain of CDKN1C cause IMAGe syndrome. Mutations in the PCNA-binding domain of CDKN1C cause IMAGe syndrome. Nat. Genet. (1061-4036) 2012 imex curation Arboleda V.A., Lee H., Parnaik R., Fleming A., Banerjee A., Ferraz-de-Souza B., Délot E.C., Rodriguez-Fernandez I.A., Braslavsky D., Bergadá I., Dell'Angelica E.C., Nelson S.F., Martinez-Agosto J.A., Achermann J.C., Vilain E. Interactions fig. S5c omitted as the involved 'importin-alpha' (detected by western blot) cannot be mapped to a UniProt Ac No. evilain@ucla.edu 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Arboleda V.A., Lee H., Parnaik R., Fleming A., Banerjee A., Ferraz-de-Souza B., Délot E.C., Rodriguez-Fernandez I.A., Braslavsky D., Bergadá I., Dell'Angelica E.C., Nelson S.F., Martinez-Agosto J.A., Achermann J.C., Vilain E. Interactions fig. S5c omitted as the involved 'importin-alpha' (detected by western blot) cannot be mapped to a UniProt Ac No. evilain@ucla.edu Accepted 2013-SEP-25 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. Nat. Genet. (1061-4036) 2012 Only protein-protein interactions imex curation cdn1c_human Cyclin-dependent kinase inhibitor 1C Cyclin-dependent kinase inhibitor p57 p57Kip2 CDKN1C KIP2 protein protein human Homo sapiens Human MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR A94CCBF09F8CB3E4 pcna_human Proliferating cell nuclear antigen PCNA Cyclin protein protein human Homo sapiens Human MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS DIP protein P12004 original sequence version: 200 DIP protein P12004 original sequence version: 128 DIP protein P12004 original sequence version: 139 DIP protein P12004 original sequence version: 185 DIP protein P12004 original sequence version: 102 DIP protein P12004 original sequence version: 105 DIP protein P12004 original sequence version: 158 E6F08E7EDBC48B00 cdkn1c-pcna 1 2 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection P49918:p.Phe276Val mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain F V Wed May 02 15:27:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe276val' Tue Jun 30 20:20:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe276Val' UniProt FTId: VAR_068850 region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P49918:p.Lys278Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K E Wed May 02 15:51:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys278glu' Tue Jun 30 17:14:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys278Glu' UniProt FTId: VAR_068851 3 unspecified role unspecified role prey prey physical association physical association 4C