bhf-ucl TBC1D14 regulates autophagosome formation via Rab11- and ULK1-positive recycling endosomes. TBC1D14 regulates autophagosome formation via Rab11- and ULK1-positive recycling endosomes. J. Cell Biol. (0021-9525) 2012 imex curation Longatti A., Lamb C.A., Razi M., Yoshimura S., Barr F.A., Tooze S.A. Cardiac - Interactions involving cardiac related proteins sharon.tooze@cancer.org.uk 30-Sept-2013: Contacted by IntAct-Help. cited in paper as Fuchs et al., 2005 = PMID 16473624 Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Longatti A., Lamb C.A., Razi M., Yoshimura S., Barr F.A., Tooze S.A. Cardiac - Interactions involving cardiac related proteins sharon.tooze@cancer.org.uk Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. cited in paper as Fuchs et al., 2005 = PMID 16473624 J. Cell Biol. (0021-9525) 2012 imex curation TBC1D14 regulates autophagosome formation via Rab11- and ULK1-positive recycling endosomes. TBC1D14 regulates autophagosome formation via Rab11- and ULK1-positive recycling endosomes. J. Cell Biol. (0021-9525) 2012 imex curation Longatti A., Lamb C.A., Razi M., Yoshimura S., Barr F.A., Tooze S.A. Cardiac - Interactions involving cardiac related proteins sharon.tooze@cancer.org.uk 30-Sept-2013: Contacted by IntAct-Help. cited in paper as Fuchs et al., 2005 = PMID 16473624 Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Longatti A., Lamb C.A., Razi M., Yoshimura S., Barr F.A., Tooze S.A. Cardiac - Interactions involving cardiac related proteins sharon.tooze@cancer.org.uk Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. cited in paper as Fuchs et al., 2005 = PMID 16473624 J. Cell Biol. (0021-9525) 2012 imex curation TBC1D14 regulates autophagosome formation via Rab11- and ULK1-positive recycling endosomes. TBC1D14 regulates autophagosome formation via Rab11- and ULK1-positive recycling endosomes. J. Cell Biol. (0021-9525) 2012 imex curation Longatti A., Lamb C.A., Razi M., Yoshimura S., Barr F.A., Tooze S.A. Cardiac - Interactions involving cardiac related proteins sharon.tooze@cancer.org.uk 30-Sept-2013: Contacted by IntAct-Help. cited in paper as Fuchs et al., 2005 = PMID 16473624 Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Longatti A., Lamb C.A., Razi M., Yoshimura S., Barr F.A., Tooze S.A. Cardiac - Interactions involving cardiac related proteins the gfp tagged c-terminal (224-669 aa) includes the TCB domain (401-611 aa). I mapped this: xref PS50086. Is this correct? sharon.tooze@cancer.org.uk Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. cited in paper as Fuchs et al., 2005 = PMID 16473624 J. Cell Biol. (0021-9525) 2012 imex curation TBC1D14 regulates autophagosome formation via Rab11- and ULK1-positive recycling endosomes. TBC1D14 regulates autophagosome formation via Rab11- and ULK1-positive recycling endosomes. J. Cell Biol. (0021-9525) 2012 imex curation Longatti A., Lamb C.A., Razi M., Yoshimura S., Barr F.A., Tooze S.A. Cardiac - Interactions involving cardiac related proteins sharon.tooze@cancer.org.uk 30-Sept-2013: Contacted by IntAct-Help. cited in paper as Fuchs et al., 2005 = PMID 16473624 Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Longatti A., Lamb C.A., Razi M., Yoshimura S., Barr F.A., Tooze S.A. Cardiac - Interactions involving cardiac related proteins sharon.tooze@cancer.org.uk Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. cited in paper as Fuchs et al., 2005 = PMID 16473624 J. Cell Biol. (0021-9525) 2012 imex curation TBC1D14 regulates autophagosome formation via Rab11- and ULK1-positive recycling endosomes. TBC1D14 regulates autophagosome formation via Rab11- and ULK1-positive recycling endosomes. J. Cell Biol. (0021-9525) 2012 imex curation Longatti A., Lamb C.A., Razi M., Yoshimura S., Barr F.A., Tooze S.A. Cardiac - Interactions involving cardiac related proteins sharon.tooze@cancer.org.uk 30-Sept-2013: Contacted by IntAct-Help. cited in paper as Fuchs et al., 2005 = PMID 16473624 Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Longatti A., Lamb C.A., Razi M., Yoshimura S., Barr F.A., Tooze S.A. Cardiac - Interactions involving cardiac related proteins sharon.tooze@cancer.org.uk Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. cited in paper as Fuchs et al., 2005 = PMID 16473624 J. Cell Biol. (0021-9525) 2012 imex curation TBC1D14 regulates autophagosome formation via Rab11- and ULK1-positive recycling endosomes. TBC1D14 regulates autophagosome formation via Rab11- and ULK1-positive recycling endosomes. J. Cell Biol. (0021-9525) 2012 imex curation Longatti A., Lamb C.A., Razi M., Yoshimura S., Barr F.A., Tooze S.A. Cardiac - Interactions involving cardiac related proteins sharon.tooze@cancer.org.uk 30-Sept-2013: Contacted by IntAct-Help. cited in paper as Fuchs et al., 2005 = PMID 16473624 Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging anti-tag immunocytochemistry anti-tag immunocytochemistry Longatti A., Lamb C.A., Razi M., Yoshimura S., Barr F.A., Tooze S.A. Cardiac - Interactions involving cardiac related proteins sharon.tooze@cancer.org.uk Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. cited in paper as Fuchs et al., 2005 = PMID 16473624 J. Cell Biol. (0021-9525) 2012 imex curation TBC1D14 regulates autophagosome formation via Rab11- and ULK1-positive recycling endosomes. TBC1D14 regulates autophagosome formation via Rab11- and ULK1-positive recycling endosomes. J. Cell Biol. (0021-9525) 2012 imex curation Longatti A., Lamb C.A., Razi M., Yoshimura S., Barr F.A., Tooze S.A. Cardiac - Interactions involving cardiac related proteins sharon.tooze@cancer.org.uk 30-Sept-2013: Contacted by IntAct-Help. cited in paper as Fuchs et al., 2005 = PMID 16473624 Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down anti tag western anti tag western blot anti tag western Longatti A., Lamb C.A., Razi M., Yoshimura S., Barr F.A., Tooze S.A. Cardiac - Interactions involving cardiac related proteins sharon.tooze@cancer.org.uk Accepted 2013-SEP-16 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. cited in paper as Fuchs et al., 2005 = PMID 16473624 J. Cell Biol. (0021-9525) 2012 imex curation atg13_human Autophagy-related protein 13 ATG13 KIAA0652 protein protein human Homo sapiens Human METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ DIP protein O75143 original sequence version: 96 DIP protein O75143-1 original sequence version: 104 DIP protein O75143 original sequence version: 109 DIP protein O75143-1 original sequence version: 121 DIP protein O75143 original sequence version: 107 DIP protein O75143 original sequence version: 115 4D6905985EAB78A7 ulk1_human Serine/threonine-protein kinase ULK1 ULK1 KIAA0722 Unc-51-like kinase 1 Autophagy-related protein 1 homolog protein protein human Homo sapiens Human MEPGRGGTETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLLGKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHAMRTLSEDTIRLFLQQIAGAMRLLHSKGIIHRDLKPQNILLSNPAGRRANPNSIRVKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLVPTIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASPSVRKSPPVPVPSYPSSGSGSSSSSSSTSHLASPPSLGEMQQLQKTLASPADTAGFLHSSRDSGGSKDSSCDTDDFVMVPAQFPGDLVAEAPSAKPPPDSLMCSGSSLVASAGLESHGRTPSPSPPCSSSPSPSGRAGPFSSSRCGASVPIPVPTQVQNYQRIERNLQSPTQFQTPRSSAIRRSGSTSPLGFARASPSPPAHAEHGGVLARKMSLGGGRPYTPSPQVGTIPERPGWSGTPSPQGAEMRGGRSPRPGSSAPEHSPRTSGLGCRLHSAPNLSDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCRNLRGSPKLPDFLQRNPLPPILGSPTKAVPSFDFPKTPSSQNLLALLARQGVVMTPPRNRTLPDLSEVGPFHGQPLGPGLRPGEDPKGPFGRSFSTSRLTDLLLKAAFGTQAPDPGSTESLQEKPMEIAPSAGFGGSLHPGARAGGTSSPSPVVFTVGSPPSGSTPPQGPRTRMFSAGPTGSASSSARHLVPGPCSEAPAPELPAPGHGCSFADPITANLEGAVTFEAPDLPEETLMEQEHTEILRGLRFTLLFVQHVLEIAALKGSASEAAGGPEYQLQESVVADQISLLSREWGFAEQLVLYLKVAELLSSGLQSAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQRFFLDKQRLLDRIHSITAERLIFSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEGLQHMLSDQADIENVTKCKLCIERRLSALLTGICA DIP protein O75385 original sequence version: 129 DIP protein O75385 original sequence version: 141 DIP protein O75385 original sequence version: 133 DIP protein O75385 original sequence version: 132 DIP protein O75385 original sequence version: 142 AED9BD5139F2DB92 atg9a_human Autophagy-related protein 9A APG9-like 1 ATG9A APG9L1 mATG9 protein protein human Homo sapiens Human MAQFDTEYQRLEASYSDSPPGEEDLLVHVAEGSKSPWHHIENLDLFFSRVYNLHQKNGFTCMLIGEIFELMQFLFVVAFTTFLVSCVDYDILFANKMVNHSLHPTEPVKVTLPDAFLPAQVCSARIQENGSLITILVIAGVFWIHRLIKFIYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELDIYHRILRFQNYMVALVNKSLLPLRFRLPGLGEAVFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRLELAQRLSNRILWIGIANFLLCPLILIWQILYAFFSYAEVLKREPGALGARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGAFFAGSILAVLIALTIYDEDVLAVEHVLTTVTLLGVTVTVCRSFIPDQHMVFCPEQLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLRPRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTELSLMHFAITNPGWQPPRESTAFLGFLKEQVQRDGAAASLAQGGLLPENALFTSIQSLQSESEPLSLIANVVAGSSCRGPPLPRDLQGSRHRAEVASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLVLSEYASTEMSLHALYMHQLHKQQAQAEPERHVWHRRESDESGESAPDEGGEGARAPQSIPRSASYPCAAPRPGAPETTALHGGFQRRYGGITDPGTVPRVPSHFSRLPLGGWAEDGQSASRHPEPVPEEGSEDELPPQVHKV 69BE087CA550DC42 tbc14_human TBC1 domain family member 14 KIAA1322 TBC1D14 protein protein human Homo sapiens Human MTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKLKLRALEDRHSLQSVDSGIPTLEIGNPEPVPCSAVHVRRKQSDSDLIPERAFQSACALPSCAPPAPSSTEREQSVRKSSTFPRTGYDSVKLYSPTSKALTRSDDVSVCSVSSLGTELSTTLSVSNEDILDLVVTSSSSAIVTLENDDDPQFTNVTLSSIKETRGLHQQDCVHEAEEGSKLKILGPFSNFFARNLLARKQSARLDKHNDLGWKLFGKAPLRENAQKDSKRIQKEYEDKAGRPSKPPSPKQNVRKNLDFEPLSTTALILEDRPANLPAKPAEEAQKHRQQYEEMVVQAKKRELKEAQRRKKQLEERCRVEESIGNAVLTWNNEILPNWETMWCSRKVRDLWWQGIPPSVRGKVWSLAIGNELNITHELFDICLARAKERWRSLSTGGSEVENEDAGFSAADREASLELIKLDISRTFPNLCIFQQGGPYHDMLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNLTPDIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTALGILKLFEDILTKMDFIHMAQFLTRLPEDLPAEELFASIATIQMQSRNKKWAQVLTALQKDSREMEKGSPSLRH 6E1332D236DE45BD rb11b_human Ras-related protein Rab-11B GTP-binding protein YPT3 RAB11B YPT3 protein protein human Homo sapiens Human MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL DIP protein Q15907 original sequence version: 139 8DF146BA39EBD9FF tfr1_human Transferrin receptor protein 1 TFRC T9 p90 protein protein human Homo sapiens Human MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNMEGDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSGVGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLRKQNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF DIP protein P02786 original sequence version: 191 DIP protein P02786 original sequence version: 117 DIP protein P02786 original sequence version: 139 DIP protein P02786 original sequence version: 146 DIP protein P02786 original sequence version: 137 DIP protein P02786 original sequence version: 150 DIP protein P02786 original sequence version: 160 DIP protein P02786 original sequence version: 190 C886F14000D90154 rb11a_human Ras-related protein Rab-11A YL8 RAB11A RAB11 protein protein human Homo sapiens Human MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI DIP protein P62491 original sequence version: 38 DIP protein P62491-1 original sequence version: 132 DIP protein P62491 original sequence version: 122 DIP protein P62491 original sequence version: 89 DIP protein P62491-1 original sequence version: 137 DIP protein P62491 original sequence version: 136 DIP protein P62491 original sequence version: 137 DIP protein P62491-1 original sequence version: 140 76FC1E113A29B269 rfip3_human Rab11 family-interacting protein 3 RAB11FIP3 KIAA0665 EF hands-containing Rab-interacting protein ARFO1 Arfophilin-1 MU-MB-17.148 protein protein human Homo sapiens Human MASAPPASPPGSEPPGPDPEPGGPDGPGAAQLAPGPAELRLGAPVGGPDPQSPGLDEPAPGAAADGGARWSAGPAPGLEGGPRDPGPSAPPPRSGPRGQLASPDAPGPGPRSEAPLPELDPLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGSPPQPSDLSQTHPLPSEPVGSQEDGPRLRAVFDALDGDGDGFVRIEDFIQFATVYGAEQVKDLTKYLDPSGLGVISFEDFYQGITAIRNGDPDGQCYGGVASAQDEEPLACPDEFDDFVTYEANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEGDADSAGGSAVPSECLDAMEEPDHGALLLLPGRPHPHGQSVITVIGGEEHFEDYGEGSEAELSPETLCNGQLGCSDPAFLTPSPTKRLSSKKVARYLHQSGALTMEALEDPSPELMEGPEEDIADKVVFLERRVLELEKDTAATGEQHSRLRQENLQLVHRANALEEQLKEQELRACEMVLEETRRQKELLCKMEREKSIEIENLQTRLQQLDEENSELRSCTPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLKLEAEQRRGRSSSMGLQEYHSRARESELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLFSTAFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEVK mint 264CEC399F28AFB9 ulk1-tbc1d14-1 4 9 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey c terminus gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c terminus region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure S2 C & D tbc1d14-ulk1-3 6 11 tag fluorescence tag visualisation by fluorescence tag fluorescence anti-tag immunocytochemistry anti-tag immunocytochemistry unspecified role unspecified role neutral component neutral component gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component colocalization colocalization Figure 2A ulk1-tbc1d14 1 11 unspecified role unspecified role prey prey Q9P2M4:p.Arg472Ala mutation mutation certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:46:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg472ala' Tue Jun 30 20:10:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg472Ala' 9 unspecified role unspecified role bait bait physical association physical association Figure S2 B tbc1d14-ulk1-5 3 11 unspecified role unspecified role unspecified role unspecified role c terminus gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role unspecified role unspecified role myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 33 36 physical association physical association Figure 2 D E & F. tbc1d14-rab11a-2 5 14 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait Q9P2M4:p.Arg472Ala mutation mutation certain certain sequence position certain certain certain sequence position certain R A Wed May 02 16:28:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg472ala' Tue Jun 30 18:11:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg472Ala' physical association physical association Figure 4 A rab11b-tbc1d14 2 11 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait Q15907:p.Ser25Asn mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S N Wed May 02 15:35:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser25asn' Tue Jun 30 19:52:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser25Asn' gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q15907:p.Gln70Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain Q A Wed May 02 14:57:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln70ala' Tue Jun 30 18:02:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln70Ala' physical association physical association Figure 4 D atg13-tbc1d14-1 6 8 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Figure 7 A Alexa Fluor 647-Tfn also colocalized with TBC1D14 and Atg13. However, its source could not be traced. tbc1d14-tfr1 6 13 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Figure 7 B & C Authors state: We quantified the extent of colocalization of overexpressed GFP-TBC1D14 and TfnR and found that the colocalization of TfnR-positive REs with GFP-TBC1D14 was independent of starvation. atg9a-tfr1-1 6 10 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization Figure 8 A, B, C, D & E Author states: The colocalization of ULK1 and TfnR was unaffected by starvation. tbc1d14-rab11b-3 5 11 unspecified role unspecified role bait bait Q9P2M4:p.Arg472Ala mutation mutation certain certain sequence position certain certain certain sequence position certain R A Wed May 02 19:13:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg472ala' Tue Jun 30 17:18:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg472Ala' 12 unspecified role unspecified role prey prey physical association physical association Figure 4 A rab11fip3-tbc1d14 7 15 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 4 C FIP3 in UniProt has 1-756 aa while the paper states using 300-759 aa. Is it correct to use UniProt's? Also I added Rab11 as "ancillary" because even though binding happens without it, it is much stronger in its presence. Not very sure about this one, please advise. Author states: However, small amounts of TBC1D14 were detected bound to GST-FIP3, and substantially higher amounts of TBC1D14 were bound to GST-FIP3 in the presence of activated Rab11bQ70A.