IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Regulation of RCAN1 protein activity by Dyrk1A protein-mediated phosphorylation. Regulation of RCAN1 protein activity by Dyrk1A protein-mediated phosphorylation. J. Biol. Chem. (0021-9258) 2011 imex curation Jung M.S., Park J.H., Ryu Y.S., Choi S.H., Yoon S.H., Kwen M.Y., Oh J.Y., Song W.J., Chung S.H. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease CALN - calcineurin is a heterodimer of calcineurin A -isozymes (PPP3CA, PPP3CB, and PPP3CC) and calcineurin B- (PPP3R1 or PPP3R2). Interactions involving CALN (calcineurin) cannot be included as the antibody specificity/identity of the molecule is unknown. The identity of GSKbeta is also not known. wjsong@inje.ac.kr,sulchung@inje.ac.kr 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions rat-cortical_neuron Rat cortical Neurons brain-cortex_neuron Cerebral cortical neuron fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Jung M.S., Park J.H., Ryu Y.S., Choi S.H., Yoon S.H., Kwen M.Y., Oh J.Y., Song W.J., Chung S.H. Parkinsons - Interactions investigated in the context of Parkinsons disease CALN - calcineurin is a heterodimer of calcineurin A -isozymes (PPP3CA, PPP3CB, and PPP3CC) and calcineurin B- (PPP3R1 or PPP3R2). Interactions involving CALN (calcineurin) cannot be included as the antibody specificity/identity of the molecule is unknown. The identity of GSKbeta is also not known. wjsong@inje.ac.kr,sulchung@inje.ac.kr Accepted 2013-NOV-08 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Regulation of RCAN1 protein activity by Dyrk1A protein-mediated phosphorylation. Regulation of RCAN1 protein activity by Dyrk1A protein-mediated phosphorylation. J. Biol. Chem. (0021-9258) 2011 imex curation Jung M.S., Park J.H., Ryu Y.S., Choi S.H., Yoon S.H., Kwen M.Y., Oh J.Y., Song W.J., Chung S.H. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease CALN - calcineurin is a heterodimer of calcineurin A -isozymes (PPP3CA, PPP3CB, and PPP3CC) and calcineurin B- (PPP3R1 or PPP3R2). Interactions involving CALN (calcineurin) cannot be included as the antibody specificity/identity of the molecule is unknown. The identity of GSKbeta is also not known. wjsong@inje.ac.kr,sulchung@inje.ac.kr 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jung M.S., Park J.H., Ryu Y.S., Choi S.H., Yoon S.H., Kwen M.Y., Oh J.Y., Song W.J., Chung S.H. Parkinsons - Interactions investigated in the context of Parkinsons disease CALN - calcineurin is a heterodimer of calcineurin A -isozymes (PPP3CA, PPP3CB, and PPP3CC) and calcineurin B- (PPP3R1 or PPP3R2). Interactions involving CALN (calcineurin) cannot be included as the antibody specificity/identity of the molecule is unknown. The identity of GSKbeta is also not known. wjsong@inje.ac.kr,sulchung@inje.ac.kr Accepted 2013-NOV-08 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Regulation of RCAN1 protein activity by Dyrk1A protein-mediated phosphorylation. Regulation of RCAN1 protein activity by Dyrk1A protein-mediated phosphorylation. J. Biol. Chem. (0021-9258) 2011 imex curation Jung M.S., Park J.H., Ryu Y.S., Choi S.H., Yoon S.H., Kwen M.Y., Oh J.Y., Song W.J., Chung S.H. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease CALN - calcineurin is a heterodimer of calcineurin A -isozymes (PPP3CA, PPP3CB, and PPP3CC) and calcineurin B- (PPP3R1 or PPP3R2). Interactions involving CALN (calcineurin) cannot be included as the antibody specificity/identity of the molecule is unknown. The identity of GSKbeta is also not known. wjsong@inje.ac.kr,sulchung@inje.ac.kr 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jung M.S., Park J.H., Ryu Y.S., Choi S.H., Yoon S.H., Kwen M.Y., Oh J.Y., Song W.J., Chung S.H. Parkinsons - Interactions investigated in the context of Parkinsons disease CALN - calcineurin is a heterodimer of calcineurin A -isozymes (PPP3CA, PPP3CB, and PPP3CC) and calcineurin B- (PPP3R1 or PPP3R2). Interactions involving CALN (calcineurin) cannot be included as the antibody specificity/identity of the molecule is unknown. The identity of GSKbeta is also not known. wjsong@inje.ac.kr,sulchung@inje.ac.kr Accepted 2013-NOV-08 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Regulation of RCAN1 protein activity by Dyrk1A protein-mediated phosphorylation. Regulation of RCAN1 protein activity by Dyrk1A protein-mediated phosphorylation. J. Biol. Chem. (0021-9258) 2011 imex curation Jung M.S., Park J.H., Ryu Y.S., Choi S.H., Yoon S.H., Kwen M.Y., Oh J.Y., Song W.J., Chung S.H. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease CALN - calcineurin is a heterodimer of calcineurin A -isozymes (PPP3CA, PPP3CB, and PPP3CC) and calcineurin B- (PPP3R1 or PPP3R2). Interactions involving CALN (calcineurin) cannot be included as the antibody specificity/identity of the molecule is unknown. The identity of GSKbeta is also not known. wjsong@inje.ac.kr,sulchung@inje.ac.kr 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Jung M.S., Park J.H., Ryu Y.S., Choi S.H., Yoon S.H., Kwen M.Y., Oh J.Y., Song W.J., Chung S.H. Parkinsons - Interactions investigated in the context of Parkinsons disease CALN - calcineurin is a heterodimer of calcineurin A -isozymes (PPP3CA, PPP3CB, and PPP3CC) and calcineurin B- (PPP3R1 or PPP3R2). Interactions involving CALN (calcineurin) cannot be included as the antibody specificity/identity of the molecule is unknown. The identity of GSKbeta is also not known. wjsong@inje.ac.kr,sulchung@inje.ac.kr Accepted 2013-NOV-08 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Regulation of RCAN1 protein activity by Dyrk1A protein-mediated phosphorylation. Regulation of RCAN1 protein activity by Dyrk1A protein-mediated phosphorylation. J. Biol. Chem. (0021-9258) 2011 imex curation Jung M.S., Park J.H., Ryu Y.S., Choi S.H., Yoon S.H., Kwen M.Y., Oh J.Y., Song W.J., Chung S.H. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease CALN - calcineurin is a heterodimer of calcineurin A -isozymes (PPP3CA, PPP3CB, and PPP3CC) and calcineurin B- (PPP3R1 or PPP3R2). Interactions involving CALN (calcineurin) cannot be included as the antibody specificity/identity of the molecule is unknown. The identity of GSKbeta is also not known. wjsong@inje.ac.kr,sulchung@inje.ac.kr 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Jung M.S., Park J.H., Ryu Y.S., Choi S.H., Yoon S.H., Kwen M.Y., Oh J.Y., Song W.J., Chung S.H. Parkinsons - Interactions investigated in the context of Parkinsons disease CALN - calcineurin is a heterodimer of calcineurin A -isozymes (PPP3CA, PPP3CB, and PPP3CC) and calcineurin B- (PPP3R1 or PPP3R2). Interactions involving CALN (calcineurin) cannot be included as the antibody specificity/identity of the molecule is unknown. The identity of GSKbeta is also not known. wjsong@inje.ac.kr,sulchung@inje.ac.kr Accepted 2013-NOV-08 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Regulation of RCAN1 protein activity by Dyrk1A protein-mediated phosphorylation. Regulation of RCAN1 protein activity by Dyrk1A protein-mediated phosphorylation. J. Biol. Chem. (0021-9258) 2011 imex curation Jung M.S., Park J.H., Ryu Y.S., Choi S.H., Yoon S.H., Kwen M.Y., Oh J.Y., Song W.J., Chung S.H. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease CALN - calcineurin is a heterodimer of calcineurin A -isozymes (PPP3CA, PPP3CB, and PPP3CC) and calcineurin B- (PPP3R1 or PPP3R2). Interactions involving CALN (calcineurin) cannot be included as the antibody specificity/identity of the molecule is unknown. The identity of GSKbeta is also not known. wjsong@inje.ac.kr,sulchung@inje.ac.kr 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Jung M.S., Park J.H., Ryu Y.S., Choi S.H., Yoon S.H., Kwen M.Y., Oh J.Y., Song W.J., Chung S.H. Parkinsons - Interactions investigated in the context of Parkinsons disease Interactions involving GSK beta and pre-phosphorylated RCAN1 cannot be included as the species of GSK beta is not stated. (In these experiments some background/residual phosphorylation of GST-RCAN1 by Dyrk1A is observed.) CALN - calcineurin is a heterodimer of calcineurin A -isozymes (PPP3CA, PPP3CB, and PPP3CC) and calcineurin B- (PPP3R1 or PPP3R2). Interactions involving CALN (calcineurin) cannot be included as the antibody specificity/identity of the molecule is unknown. The identity of GSKbeta is also not known. wjsong@inje.ac.kr,sulchung@inje.ac.kr Accepted 2013-NOV-08 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation p53805-2 Calcipressin-1 RCAN1 ADAPT78 CSP1 DSC1 DSCR1 Adapt78 Down syndrome critical region protein 1 Myocyte-enriched calcineurin-interacting protein 1 Regulator of calcineurin 1 CALP1-S protein protein human Homo sapiens Human MHFRNFNYSFSSLIACVANSDIFSESETRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS 980A1FD7AA54A238 dyr1a_rat Dual specificity tyrosine-phosphorylation-regulated kinase 1A Dyrk1a Dyrk Dual specificity YAK1-related kinase Protein kinase minibrain homolog RP86 protein protein rat Rattus norvegicus (Rat) Rat MHTGGETSACKPSSVRLAPSFSFHAAGLQMAAQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQVMPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWSLKKTKDGKREYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGGHFAAAVQAMDCETHSPQVRQQFPAPLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHHHHGNSSHHHHHHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS mint homomint May play a role in a signaling pathway regulating nuclear functions of cell proliferation. Phosphorylates serine, threonine and tyrosine residues in its sequence and in exogenous substrates CB5EC7EC4C1F9A47 rcan1_mouse Calcipressin-1 Regulator of calcineurin 1 Down syndrome critical region protein 1 homolog Myocyte-enriched calcineurin-interacting protein 1 Rcan1 Dscr1 protein protein mouse Mus musculus Mouse MEDGVAGPRLGEVAEAVEARAPRRVTLRPFAPFSAAAEGDGGGGGDWSFIDCEMEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDTTFQYFKSFKRVRINFSNPLSAADARLRLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQENEEEEEEMERMKRPKPKIIQTRRPEYTPIHLS 09F47C73D847FB2B rcan1_rat Calcipressin-1 Dscr1 Down syndrome critical region protein 1 homolog Rcan1 Myocyte-enriched calcineurin-interacting protein 1 Regulator of calcineurin 1 protein protein rat Rattus norvegicus (Rat) Rat MHFRDFNYNFSSLIACVANGDVFSESETRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPLSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEEEEEEEEEMERMKRPKPKIIQTRRPEYTPIHLS 3BA20EE4BD59F0BB dyr1a_mouse Dual specificity tyrosine-phosphorylation-regulated kinase 1A Dyrk1a Dyrk Protein kinase minibrain homolog MP86 Dual specificity YAK1-related kinase protein protein mouse Mus musculus Mouse MHTGGETSACKPSSVRLAPSFSFHAAGLQMAAQMPHSHQYSDRRQPSISDQQVSALPYSDQIQQPLTNQVMPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWSLKKTKDGKREYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGGHFAAAVQAMDCETHSPQVRQQFPAPLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHHHHGNSSHHHHHHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLAMRQGADREESPMTGVCVQQSPVASS E117DDD6C5E8C74F dyrk1a-rcan1 3 11 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 1A rcan1-dyrk1a 3 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 1A dyrk1a-rcan1-1 2 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 1B rcan1-dyrk1a-1 2 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 1B rcan1-dyrk1a-2 4 11 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1C dyrk1a-rcan1-2 6 7 enzyme target enzyme target substrate substrate neutral component neutral component P53805-2:p.Ser112Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 20:18:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser112ala' Tue Jun 30 18:05:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser112Ala' c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P53805-2:p.Thr192Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T A Wed May 02 14:42:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr192ala' Tue Jun 30 16:28:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr192Ala' P53805-2:p.[Ser112Ala;Thr192Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Fri Jul 22 11:00:08 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'thr192ala,ser112ala' Wed May 02 17:33:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser112ala,thr192ala' Tue Jun 30 20:20:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser112Ala;Thr192Ala]' n_terminus s tag s tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 11 enzyme enzyme neutral component neutral component Q61214:p.Tyr321Phe mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 17:57:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr321phe' Tue Jun 30 19:37:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr321Phe' c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Fig. 2A/B dyrk1a-2 6 11 enzyme enzyme neutral component neutral component Q61214:p.Tyr321Phe mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 19:26:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr321phe' Tue Jun 30 19:27:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr321Phe' c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Fig. 2A dyrk1a-rcan1-3 6 7 enzyme target enzyme target substrate substrate neutral component neutral component P53805-2:p.Ser112Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:23:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser112ala' Tue Jun 30 20:23:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser112Ala' P53805-2:p.Thr192Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T A Wed May 02 15:08:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr192ala' Tue Jun 30 16:41:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr192Ala' n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 11 enzyme enzyme neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Fig. 3 dyrk1a-rcan1-4 5 8 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component possible_phospho_193thr opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain colocalization colocalization 7A dyrk1a-rcan1-5 1 8 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component possible_phospho_193thr opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain colocalization colocalization 7B, Supp fig 6.