UniProt UniProt http://www.uniprot.org Human cytomegalovirus infection causes degradation of Sp100 proteins that suppress viral gene expression. Human cytomegalovirus infection causes degradation of Sp100 proteins that suppress viral gene expression. J. Virol. (0022-538X) 2011 imex curation Kim Y.E., Lee J.H., Kim E.T., Shin H.J., Gu S.Y., Seol H.S., Ling P.D., Lee C.H., Ahn J.H. Origin of HCMV according ref. 30 (pmid 15163746), of SP100 according ref. 32 (pmid 16177824) and mentioned sumoylation site. Origin of SUMO-1 was found in reference 5 (pmid:11264375). jahn@skku.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kim Y.E., Lee J.H., Kim E.T., Shin H.J., Gu S.Y., Seol H.S., Ling P.D., Lee C.H., Ahn J.H. Origin of HCMV according ref. 30 (pmid 15163746), of SP100 according ref. 32 (pmid 16177824) and mentioned sumoylation site. Origin of SUMO-1 was found in reference 5 (pmid:11264375). jahn@skku.edu Accepted 2013-JUN-05 by MGT 17-Jun-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2011 Only protein-protein interactions imex curation Human cytomegalovirus infection causes degradation of Sp100 proteins that suppress viral gene expression. Human cytomegalovirus infection causes degradation of Sp100 proteins that suppress viral gene expression. J. Virol. (0022-538X) 2011 imex curation Kim Y.E., Lee J.H., Kim E.T., Shin H.J., Gu S.Y., Seol H.S., Ling P.D., Lee C.H., Ahn J.H. Origin of HCMV according ref. 30 (pmid 15163746), of SP100 according ref. 32 (pmid 16177824) and mentioned sumoylation site. Origin of SUMO-1 was found in reference 5 (pmid:11264375). jahn@skku.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kim Y.E., Lee J.H., Kim E.T., Shin H.J., Gu S.Y., Seol H.S., Ling P.D., Lee C.H., Ahn J.H. Origin of HCMV according ref. 30 (pmid 15163746), of SP100 according ref. 32 (pmid 16177824) and mentioned sumoylation site. Origin of SUMO-1 was found in reference 5 (pmid:11264375). jahn@skku.edu Accepted 2013-JUN-05 by MGT 17-Jun-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2011 Only protein-protein interactions imex curation Human cytomegalovirus infection causes degradation of Sp100 proteins that suppress viral gene expression. Human cytomegalovirus infection causes degradation of Sp100 proteins that suppress viral gene expression. J. Virol. (0022-538X) 2011 imex curation Kim Y.E., Lee J.H., Kim E.T., Shin H.J., Gu S.Y., Seol H.S., Ling P.D., Lee C.H., Ahn J.H. Origin of HCMV according ref. 30 (pmid 15163746), of SP100 according ref. 32 (pmid 16177824) and mentioned sumoylation site. Origin of SUMO-1 was found in reference 5 (pmid:11264375). jahn@skku.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kim Y.E., Lee J.H., Kim E.T., Shin H.J., Gu S.Y., Seol H.S., Ling P.D., Lee C.H., Ahn J.H. Origin of HCMV according ref. 30 (pmid 15163746), of SP100 according ref. 32 (pmid 16177824) and mentioned sumoylation site. Origin of SUMO-1 was found in reference 5 (pmid:11264375). jahn@skku.edu Accepted 2013-JUN-05 by MGT 17-Jun-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2011 Only protein-protein interactions imex curation Human cytomegalovirus infection causes degradation of Sp100 proteins that suppress viral gene expression. Human cytomegalovirus infection causes degradation of Sp100 proteins that suppress viral gene expression. J. Virol. (0022-538X) 2011 imex curation Kim Y.E., Lee J.H., Kim E.T., Shin H.J., Gu S.Y., Seol H.S., Ling P.D., Lee C.H., Ahn J.H. Origin of HCMV according ref. 30 (pmid 15163746), of SP100 according ref. 32 (pmid 16177824) and mentioned sumoylation site. Origin of SUMO-1 was found in reference 5 (pmid:11264375). jahn@skku.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim Y.E., Lee J.H., Kim E.T., Shin H.J., Gu S.Y., Seol H.S., Ling P.D., Lee C.H., Ahn J.H. Fibrobalst cells have been infected with HCMV prior to IP. Origin of HCMV according ref. 30 (pmid 15163746), of SP100 according ref. 32 (pmid 16177824) and mentioned sumoylation site. Origin of SUMO-1 was found in reference 5 (pmid:11264375). jahn@skku.edu Accepted 2013-JUN-05 by MGT 17-Jun-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2011 Only protein-protein interactions imex curation sp100_human Nuclear autoantigen Sp-100 Nuclear dot-associated Sp100 protein Speckled 100 kDa SP100 protein protein human Homo sapiens Human MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRNLVPVQRVVYNVLSELEKTFNLPVLEALFSDVNMQEYPDLIHIYKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELHNHGIQINSCSVRLVDIKKEKPFSNSKVECQAQARTHHNQASDIIVISSEDSEGSTDVDEPLEVFISAPRSEPVINNDNPLESNDEKEGQEATCSRPQIVPEPMDFRKLSTFRESFKKRVIGQDHDFSESSEEEAPAEASSGALRSKHGEKAPMTSRSTSTWRIPSRKRRFSSSDFSDLSNGEELQETCSSSLRRGSGSQPQEPENKKCSCVMCFPKGVPRSQEARTESSQASDMMDTMDVENNSTLEKHSGKRRKKRRHRSKVNGLQRGRKKDRPRKHLTLNNKVQKKRWQQRGRKANTRPLKRRRKRGPRIPKDENINFKQSELPVTCGEVKGTLYKERFKQGTSKKCIQSEDKKWFTPREFEIEGDRGASKNWKLSIRCGGYTLKVLMENKFLPEPPSTRKKRILESHNNTLVDPCEEHKKKNPDASVKFSEFLKKCSETWKTIFAKEKGKFEDMAKADKAHYEREMKTYIPPKGEKKKKFKDPNAPKRPPLAFFLFCSEYRPKIKGEHPGLSIDDVVKKLAGMWNNTAAADKQFYEKKAAKLKEKYKKDIAAYRAKGKPNSAKKRVVKAEKSKKKKEEEEDEEDEQEEENEEDDDK CA55547DE21B2A10 sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV DIP protein P63165 original sequence version: 36 DIP protein P63165 original sequence version: 40 DIP protein P63165 original sequence version: 124 DIP protein P63165 original sequence version: 125 DIP protein P63165 original sequence version: 83 DIP protein P63165 original sequence version: 85 DIP protein P63165 original sequence version: 81 DIP protein P63165 original sequence version: 84 DIP protein P63165 original sequence version: 103 DIP protein P63165 original sequence version: 100 DIP protein P63165 original sequence version: 95 DIP protein P63165 original sequence version: 98 DIP protein P63165 original sequence version: 101 DIP protein P63165-1 original sequence version: 131 DIP protein P63165 original sequence version: 102 DIP protein P63165 original sequence version: 122 DIP protein P63165 original sequence version: 62 DIP protein P63165 original sequence version: 119 DIP protein P63165 original sequence version: 82 89BE97D2D054FB33 vie1_hcmvt Immediate early protein IE1 UL123 55 kDa immediate-early protein 1 IE1p72 IE72 protein protein hcmvt Human cytomegalovirus (strain Towne) Human herpesvirus 5 MESSAKRKMDPDNPDEGPSSKVPRPETPVTKATTFLQTMLRKEVNSQLSLGDPLFPELAEESLKTFERVTEDCNENPEKDVLAELVKQIKVRVDMVRHRIKEHMLKKYTQTEEKFTGAFNMMGGCLQNALDILDKVHEPFEEMKCIGLTMQSMYENYIVPEDKREMWMACIKELHDVSKGAANKLGGALQAKARAKKDELRRKMMYMCYRNIEFFTKNSAFPKTTNGCSQAMAALQNLPQCSPDEIMAYAQKIFKILDEERDKVLTHIDHIFMDILTTCVETMCNEYKVTSDACMMTMYGGISLLSEFCRVLSCYVLEETSVMLAKRPLITKPEVISVMKRRIEEICMKVFAQYILGADPLRVCSPSVDDLRAIAEESDEEEAIVAYTLATRGASSSDSLVSPPESPVPATIPLSSVIVAENSDQEESEQSDEEEEEGAQEEREDTVSVKSEPVSEIEEVAPEEEEDGAEEPTASGGKSTHPMVTRSKADQ E6041928A91A5867 sp100-ul123 2 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 6A sp100-sp100 2 5 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 6A sp100-ul123-2 4 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 6B sp100-ul123-3 3 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 6C sp100-ul123-4 1 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro physical association physical association 6E sp100-sp100-1 2 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 6Ai