UniProt UniProt http://www.uniprot.org An Arabidopsis dual-localized pentatricopeptide repeat protein interacts with nuclear proteins involved in gene expression regulation. An Arabidopsis dual-localized pentatricopeptide repeat protein interacts with nuclear proteins involved in gene expression regulation. Plant Cell (1040-4651) 2011 imex curation Hammani K., Gobert A., Hleibieh K., Choulier L., Small I., Giegé P. philippe.giege@ibmp-crns.unistra.fr 09-Sep-2013: Contacted by IntAct-Help. Arabidopsis cDNA library - 6-d-old Arabidopsis seedlings (DualsystemsBiotech) Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Hammani K., Gobert A., Hleibieh K., Choulier L., Small I., Giegé P. philippe.giege@ibmp-crns.unistra.fr Accepted 2013-AUG-08 by MGT 09-Sep-2013: Contacted by IntAct-Help. Arabidopsis cDNA library - 6-d-old Arabidopsis seedlings (DualsystemsBiotech) Plant Cell (1040-4651) 2011 Only protein-protein interactions imex curation An Arabidopsis dual-localized pentatricopeptide repeat protein interacts with nuclear proteins involved in gene expression regulation. An Arabidopsis dual-localized pentatricopeptide repeat protein interacts with nuclear proteins involved in gene expression regulation. Plant Cell (1040-4651) 2011 imex curation Hammani K., Gobert A., Hleibieh K., Choulier L., Small I., Giegé P. philippe.giege@ibmp-crns.unistra.fr 09-Sep-2013: Contacted by IntAct-Help. Arabidopsis cDNA library - 6-d-old Arabidopsis seedlings (DualsystemsBiotech) Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hammani K., Gobert A., Hleibieh K., Choulier L., Small I., Giegé P. philippe.giege@ibmp-crns.unistra.fr Accepted 2013-AUG-08 by MGT 09-Sep-2013: Contacted by IntAct-Help. Arabidopsis cDNA library - 6-d-old Arabidopsis seedlings (DualsystemsBiotech) Plant Cell (1040-4651) 2011 Only protein-protein interactions imex curation An Arabidopsis dual-localized pentatricopeptide repeat protein interacts with nuclear proteins involved in gene expression regulation. An Arabidopsis dual-localized pentatricopeptide repeat protein interacts with nuclear proteins involved in gene expression regulation. Plant Cell (1040-4651) 2011 imex curation Hammani K., Gobert A., Hleibieh K., Choulier L., Small I., Giegé P. philippe.giege@ibmp-crns.unistra.fr 09-Sep-2013: Contacted by IntAct-Help. Arabidopsis cDNA library - 6-d-old Arabidopsis seedlings (DualsystemsBiotech) Only protein-protein interactions allium_epidermis Allium cepa (onion) epidermis A thin surface layer of tissue in higher plants formed by growth of a primary meristem. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Hammani K., Gobert A., Hleibieh K., Choulier L., Small I., Giegé P. philippe.giege@ibmp-crns.unistra.fr Accepted 2013-AUG-08 by MGT 09-Sep-2013: Contacted by IntAct-Help. Arabidopsis cDNA library - 6-d-old Arabidopsis seedlings (DualsystemsBiotech) Plant Cell (1040-4651) 2011 Only protein-protein interactions imex curation q9lpd7_arath T12C22.21 T12C22_21 At1g44920 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRMLVLRTPTGPVSAVRFITKSKPSPFSSPDSWLLPAPNTHRSRPRVVLALSNPDGSVNSKPSTSASQIPSSGDETVFVGQDNVPLEGVIQFDKPSSTSSSNITKWGRVALLAGGDVLALLIFSAIGRFSHGFPVFSLDTLHTADPFIAGWFLSAYFLGGYAEEGRGMKGKSKAVVAAAKSWIVGTPLGIIIRSASSGHIPAYSFVLVTMGSTAVLLIGWRALLFSVLPTESKKKDDTYRKGSAFELFELLTSLIRRW 25594C23C970B5C1 nap1a_arath Nucleosome assembly protein 1;1 NAP1;1 NFA1 Nucleosome/chromatin assembly factor group A1 F20B18.220 At4g26110 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNDKDSFNVSDLTAALKDEDRAGLVNALKNKLQNLAGQRSDVLENLTPNVRKRVDALRDIQSQHDELEAKFREERAILEAKYQTLYQPLYVKRYEIVNGTTEVELAPEDDTKVDQGEEKTAEEKGVPSFWLTALKNNDVISEEVTERDEGALKYLKDIKWCKIEEPKGFKLEFFFDTNPYFKNTVLTKSYHMIDEDEPLLEKAMGTEIDWYPGKCLTQKILKKKPKKGSKNTKPITKLEDCESFFNFFSPPEVPDEDEDIDEERAEDLQNLMEQDYDIGSTIREKIIPRAVSWFTGEAMEAEDFEIDDDEEDDIDEDEDEEDEEDEEDDDDEDEEESKTKKKPSIGNKKGGRSQIVGEGKQDERPPECKQQ 8AA1C7E84C0BC4D2 q9fir7_arath MXC17.7 MXC17_7 At5g24680 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSALCPVCNLTLPLSLIQSHVNSHFEDDEINPQIETDHHLALQLASDDHSSDDPSSSSSASSSNNVASLVQLQTKSQFYSVGHGGLICLLRNCLESELKLKSKPLECSTSLLSGFVDHFQSSKEDKGWGCGWKNIQMQCSHLLSHREEAKRVLFGGSNFVPDIPSLQRWLELAWNKGFDVSGALHFDNRICGSKRWIGTTECAALLRSFGLKARIVDFAPEKSKSMYLSVPGSAIAPKVKSYGPMDRYMVKKGGSGKGKAVDSHSSNSSRISKGAVLMEWVWNYFSDNRLSVSSGVHITNKGPLYFQHEGHSRTIVGVQRRLQGTTFTPQYNLLILDPADFTRAIEIALIEKRGWEGYLKRGAHTLKCPEYQMLYVDNGIADGEELEKLKTIDSHFVEF D58F385C9B10B3D2 tcp8_arath Transcription factor TCP8 TCP8 T15M6.11 T18I24.2 At1g58100 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLSDIRNNNNDTAAVATGGGARQLVDASLSIVPRSTPPEDSTLATTSSTATATTTKRSTKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGETIEWLLQQAEPAIVAATGTGTIPANFSTLSVSLRSSGSTLSAPPSKSVPLYGALGLTHHQYDEQGGGGVFAAHTSPLLGFHHQLQHHQNQNQNQDPVETIPEGENFSRKRYRSVDLSKENDDRKQNENKSLKESETSGPTAAPMWAVAPPSRSGAGNTFWMLPVPTTAGNQMESSSNNNTAAGHRAPPMWPFVNSAGGGAGGGGGAATHFMAGTGFSFPMDQYRGSPLQLGSFLAQPQPTQNLGLSMPDSNLGMLAALNSAYSRGGNANANAEQANNAVEHQEKQQQSDHDDDSREENSNSSE 9F5E817CDB11874C pp438_arath Pentatricopeptide repeat-containing protein PNM1, mitochondrial PNM1 PPR PROTEIN LOCALIZED TO THE NUCLEUS AND MITOCHONDRIA 1 MSL3.8 At5g60960 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPPSLPSLQLRRLLLRSFISSSSVNTLQSQPRIISSKPLFSPLPPSRSSIFSTFPSRFFSSETNAESESLDSNEIALSFSKELTGNPDAESQTISQRFNLSFSHITPNPDLILQTLNLSPEAGRAALGFNEWLDSNSNFSHTDETVSFFVDYFGRRKDFKGMLEIISKYKGIAGGKTLESAIDRLVRAGRPKQVTDFFEKMENDYGLKRDKESLTLVVKKLCEKGHASIAEKMVKNTANEIFPDENICDLLISGWCIAEKLDEATRLAGEMSRGGFEIGTKAYNMMLDCVCKLCRKKDPFKLQPEVEKVLLEMEFRGVPRNTETFNVLINNLCKIRRTEEAMTLFGRMGEWGCQPDAETYLVLIRSLYQAARIGEGDEMIDKMKSAGYGELLNKKEYYGFLKILCGIERLEHAMSVFKSMKANGCKPGIKTYDLLMGKMCANNQLTRANGLYKEAAKKGIAVSPKEYRVDPRFMKKKTKEVDSNVKKRETLPEKTARKKKRLKQINMSFVKKPHNKMRRRM 53CEED0D7D208E2D pnm1-nap1;1 2 5 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association no figure pnm1-q9fir7 2 8 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association pnm1-t12c22_21 2 4 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association pnm1-tcp8 2 8 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association pnm1-nap1;1 1 5 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4A pnm1-tcp8-1 1 7 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4A nap1;1-pnm1 1 8 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4A tcp8-pnm1 1 8 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4A pnm1-nap1;1 3 8 unspecified role unspecified role neutral component neutral component region bifc tag bifc tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region bifc tag bifc tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4B pnm1-tcp8-2 3 8 unspecified role unspecified role neutral component neutral component region bifc tag bifc tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component region bifc tag bifc tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4B